CASS4 Antibody - BSA Free

Western Blot: CASS4 Antibody [NBP3-10642] - Western blot analysis of CASS4 in RPMI-8226 Whole Cell lysates. Antibody dilution at 1.0ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CASS4 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CASS4. Peptide sequence ALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CASS4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CASS4 Antibody - BSA Free

• C20orf32
• Cas scaffolding protein family member 4
• HEF1-EFS-p130Cas-like protein
• HEFLchromosome 20 open reading frame 32
• HEF-like protein
• HEPLCAS4

Background

Possible docking protein which may play a role for tyrosine-kinase-based signaling related to cell adhesion.Regulates FAK activity, focal adhesion integrity, and cell spreading

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CASS4