Caspr1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Caspr1 Antibody [NBP1-88183] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Caspr1 Antibody [NBP1-88183] - Staining of human cerebral cortex shows strong cytoplasmic and nucleolar positivity in subset of neuronal cells, neuropil was distinctly stained.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Caspr1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MRLNGVTLNLEGRANASEGTSPNCTGHCAHPRLPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSAAREFSHMLSRPVPGYEPGYIPGYDTPGY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNTNAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Caspr1 Protein (NBP1-88183PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Caspr1 Antibody

  • Caspr
  • Caspr1
  • CASPRcaspr1
  • CNTNAP
  • CNTNAP1
  • contactin associated protein 1
  • neurexin 4
  • Neurexin IV
  • neurexin-4
  • NRXN4contactin-associated protein 1
  • p190

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-49154
Species: Hu
Applications: IHC
NB100-88154
Species: Hu, Mu
Applications: WB, IP, PLA
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00003736-B01P
Species: Hu
Applications: WB
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Caspr1 Antibody (NBP1-88183) (0)

There are no publications for Caspr1 Antibody (NBP1-88183).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspr1 Antibody (NBP1-88183) (0)

There are no reviews for Caspr1 Antibody (NBP1-88183). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Caspr1 Antibody (NBP1-88183) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Caspr1 Products

Bioinformatics Tool for Caspr1 Antibody (NBP1-88183)

Discover related pathways, diseases and genes to Caspr1 Antibody (NBP1-88183). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caspr1 Antibody (NBP1-88183)

Discover more about diseases related to Caspr1 Antibody (NBP1-88183).
 

Pathways for Caspr1 Antibody (NBP1-88183)

View related products by pathway.

PTMs for Caspr1 Antibody (NBP1-88183)

Learn more about PTMs related to Caspr1 Antibody (NBP1-88183).

Blogs on Caspr1

There are no specific blogs for Caspr1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Caspr1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNTNAP1
Entrez
Uniprot