Caspase-8 Antibody

Images

 
Western Blot: Caspase-8 Antibody [NBP1-88185] - Analysis in human cell line RPMI-8226.
Immunocytochemistry/ Immunofluorescence: Caspase-8 Antibody [NBP1-88185] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Caspase-8 Antibody [NBP1-88185] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center and non-germinal center cells.
Immunocytochemistry/ Immunofluorescence: Caspase-8 Antibody [NBP1-88185] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: Caspase-8 Antibody [NBP1-88185] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Caspase-8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CASP8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Caspase-8 Protein (NBP1-88185PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Caspase-8 Antibody

  • AIS
  • androgen receptor
  • CASP8
  • Caspase8
  • Caspase-8
  • DHTRTFM
  • Dihydrotestosterone receptorHYSP1
  • HUMARA
  • Mch5
  • NR3C4KD
  • Nuclear receptor subfamily 3 group C member 4
  • SMAX1SBMA
  • spinal and bulbar muscular atrophy

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
126-FL/CF
Species: Hu
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut

Publications for Caspase-8 Antibody (NBP1-88185) (0)

There are no publications for Caspase-8 Antibody (NBP1-88185).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspase-8 Antibody (NBP1-88185) (0)

There are no reviews for Caspase-8 Antibody (NBP1-88185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Caspase-8 Antibody (NBP1-88185). (Showing 1 - 1 of 1 FAQ).

  1. May we ask the MW difference between the active form and the proform of Caspase 8 while performing WB?
    • In treated cells induced to undergo apoptosis, caspase-8 migrates as a 55/53 kDa (pro-form), 41/42 kDa (a cleaved/active or intermediate form), and 18 kDa (active form). The proform (55/53 kDa) is still seen in treated cells because not all cells undergo apoptosis at once.

Secondary Antibodies

 

Isotype Controls

Additional Caspase-8 Products

Bioinformatics Tool for Caspase-8 Antibody (NBP1-88185)

Discover related pathways, diseases and genes to Caspase-8 Antibody (NBP1-88185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caspase-8 Antibody (NBP1-88185)

Discover more about diseases related to Caspase-8 Antibody (NBP1-88185).
 

Pathways for Caspase-8 Antibody (NBP1-88185)

View related products by pathway.

PTMs for Caspase-8 Antibody (NBP1-88185)

Learn more about PTMs related to Caspase-8 Antibody (NBP1-88185).
 

Research Areas for Caspase-8 Antibody (NBP1-88185)

Find related products by research area.

Blogs on Caspase-8.

Caspase 3, the executioner of apoptosis
Caspase-3 enzyme is a member of the family of endoproteases which regulate inflammation and apoptosis signaling networks. Caspase-3 is known as an executioner caspase in apoptosis because of its role in coordinating the destruction of cellular stru...  Read full blog post.

VPS41 - An important regulator of lysosomal trafficking
Membrane fusion is an essential step during the trafficking of endosomes and vesicles throughout the cell. Membrane fusion events are facilitated by multisubunit tethering complexes (MTC) including CORVET and HOPS. These complexes interact with Rab...  Read full blog post.

Caspase-8 - a pro-apoptotic protein with dynamic roles in normal physiology and pathology
Caspases are a family of cysteine-aspartic acid proteases that are responsible for the initiation and execution of apoptosis. Caspase-8 is a 55 kDa protein expressed as an inactive procaspase that resides in the cytosol. Activation of Caspase-8 req...  Read full blog post.

Caspase 8 - a key mediator of apoptosis
Programmed cell death via apoptosis is a key controlled physiological process instigated by the cell death receptor family, their ligands, and the caspase cysteine protease family. All caspases exist in a precursor form that contains a prodomain, a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Caspase-8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CASP8
Entrez