Caspase-3 Recombinant Protein Antigen

Images

 
There are currently no images for Caspase-3 Protein (NBP1-90125PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Caspase-3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CASP3.

Source: E.coli

Amino Acid Sequence: HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CASP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90125.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Caspase-3 Recombinant Protein Antigen

  • Apopain
  • apoptosis-related cysteine protease
  • CASP3
  • CASP-3
  • caspase 3, apoptosis-related cysteine peptidase
  • Caspase3
  • Caspase-3
  • CPP32
  • CPP-32
  • CPP32B
  • CPP32SREBP cleavage activity 1
  • Cysteine protease CPP32
  • EC 3.4.22
  • EC 3.4.22.56
  • LICE-1
  • PARP cleavage protease
  • procaspase3
  • Protein Yama
  • SCA-1
  • YAMA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-13732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-43728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-90125PEP
Species: Hu
Applications: AC

Publications for Caspase-3 Protein (NBP1-90125PEP) (0)

There are no publications for Caspase-3 Protein (NBP1-90125PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspase-3 Protein (NBP1-90125PEP) (0)

There are no reviews for Caspase-3 Protein (NBP1-90125PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Caspase-3 Protein (NBP1-90125PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Caspase-3 Protein (NBP1-90125PEP)

Discover related pathways, diseases and genes to Caspase-3 Protein (NBP1-90125PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caspase-3 Protein (NBP1-90125PEP)

Discover more about diseases related to Caspase-3 Protein (NBP1-90125PEP).
 

Pathways for Caspase-3 Protein (NBP1-90125PEP)

View related products by pathway.

PTMs for Caspase-3 Protein (NBP1-90125PEP)

Learn more about PTMs related to Caspase-3 Protein (NBP1-90125PEP).
 

Research Areas for Caspase-3 Protein (NBP1-90125PEP)

Find related products by research area.

Blogs on Caspase-3.

Caspase-3- A marker of programmed cell death
Caspases, or cysteine-dependent aspartate specific proteases, are a family of enzymes crucial for initiating and executing apoptosis within a cell, an important biological event especially during organ development (1). Environmental cues and cellul...  Read full blog post.

Caspase 3, the executioner of apoptosis
Caspase-3 enzyme is a member of the family of endoproteases which regulate inflammation and apoptosis signaling networks. Caspase-3 is known as an executioner caspase in apoptosis because of its role in coordinating the destruction of cellular stru...  Read full blog post.

Caspase 7 - A key effector of the apoptotic pathway
Caspase-7 is an effector caspase with important roles in mediating cell death signaling. As an effector caspase, caspase-7 is cleaved and activated by initiator caspases such as caspase-1 (1). Like other caspase family proteins, caspase-7 contains a...  Read full blog post.

Caspase 11 - A proinflammatory caspase that induces the innate immune response
While known for their role in programmed cell death, caspases are also essential for mediating inflammatory responses and innate immunity. Binding of microbial molecules by pattern recognition receptors triggers the formation of the multiprotein in...  Read full blog post.

LC3/LC3B - measuring autophagosome formation and autophagic flux
Microtubule-associated protein-1 light chain 3 (LC3/LC3B) is a ubiquitin-like protein involved in the formation of the autophagosome. It is homologous to the yeast Atg8 protein. Autophagosomes are important for the degradation and recycling of intr...  Read full blog post.

D4-GDI (GDP dissociation inhibitor, RhoGD12)
The D4-GDI protein is a negative regulator of the Ras-related Rho family of small molecule "molecular switch" GTPases. The Rho GTPases modify cell structure and architecture via rapid changes to the actin cytoskeleton and cell membrane. M...  Read full blog post.

LC3B - a novel marker for autophagosome
Autophagy, also known as macroautophagy, supplies alternative fuel for cells that are under environmental stress conditions (including starvation, growth factor deprivation, and hypoxia). This highly regulated and catabolic cell process recycles a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Caspase-3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CASP3
Entrez