Casein Kinase 1 alpha Antibody (9O4L9)

Western Blot: Casein Kinase 1 alpha Antibody (9O4L9) [NBP3-16807] - Western blot analysis of extracts of various cell lines, using Casein Kinase 1 alpha (Casein Kinase 1 alpha) Rabbit mAb (NBP3-16807) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: Casein Kinase 1 alpha Antibody (9O4L9) [NBP3-16807] - Immunohistochemistry of paraffin-embedded rat liver using Casein Kinase 1 alpha (Casein Kinase 1 alpha) Rabbit mAb (NBP3-16807) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 9O4L9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Casein Kinase 1 alpha Antibody (9O4L9) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 238-337 of human Casein Kinase 1 alpha (P48729). EKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CSNK1A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Casein Kinase 1 alpha Antibody (9O4L9)

• Casein Kinase 1 alpha
• casein kinase 1, alpha 1
• casein kinase I isoform alpha
• CK1CKI-alpha
• CSNK1A1
• down-regulated in lung cancer
• EC 2.7.11.1
• HLCDGP1
• PRO2975

Background

Casein kinase I (also designated CKI) and casein kinase II (CKII) compose a family of serine/threonine protein kinases which are present in all eukaryotes examined to date. Casein kinase I family members, which include casein kinase Ialpha, Igamma, Idelta and Iepisilon, have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. CKII is usually expressed as a tetrameric complex consisting of either an alpha2beta2 or an alphaalpha'beta2 structure. The a catalytic subunit is stimulated by the beta regulatory subunit, which undergoes autophosphorylation. Casein kinase II activity is high in the cytosol and nucleus of proliferating and differentiating cells. Casein kinase II is known to phosphorylate more than 100 different substrates including nuclear oncoproteins, transcription factors and enzymes involved in DNA metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSNK1A1