CASD1 Antibody

Images

 
Western Blot: CASD1 Antibody [NBP1-69609] - This Anti-CASD1 antibody was used in Western Blot of THP-1 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CASD1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CASD1(CAS1 domain containing 1) The peptide sequence was selected from the N terminal of CASD1. Peptide sequence MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CASD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CASD1 and was validated on Western blot.
Theoretical MW
91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CASD1 Antibody

  • C7orf12O-acetyltransferase
  • CAS1 domain containing 1
  • CAS1 domain-containing protein 1
  • FLJ21213
  • FLJ21879
  • FLJ41901
  • NBLA04196
  • WUGSC:H_GS542D18.2

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NBP1-60103
Species: Hu
Applications: WB, IHC
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-81010
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC

Publications for CASD1 Antibody (NBP1-69609) (0)

There are no publications for CASD1 Antibody (NBP1-69609).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CASD1 Antibody (NBP1-69609) (0)

There are no reviews for CASD1 Antibody (NBP1-69609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CASD1 Antibody (NBP1-69609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CASD1 Products

Bioinformatics Tool for CASD1 Antibody (NBP1-69609)

Discover related pathways, diseases and genes to CASD1 Antibody (NBP1-69609). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CASD1 Antibody (NBP1-69609)

Discover more about diseases related to CASD1 Antibody (NBP1-69609).
 

Pathways for CASD1 Antibody (NBP1-69609)

View related products by pathway.

PTMs for CASD1 Antibody (NBP1-69609)

Learn more about PTMs related to CASD1 Antibody (NBP1-69609).

Blogs on CASD1

There are no specific blogs for CASD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CASD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CASD1
Uniprot