CASD1 Antibody


Western Blot: CASD1 Antibody [NBP1-69609] - This Anti-CASD1 antibody was used in Western Blot of THP-1 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CASD1 Antibody Summary

Synthetic peptides corresponding to CASD1(CAS1 domain containing 1) The peptide sequence was selected from the N terminal of CASD1. Peptide sequence MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CASD1 and was validated on Western blot.
Theoretical MW
91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CASD1 Antibody

  • C7orf12O-acetyltransferase
  • CAS1 domain containing 1
  • CAS1 domain-containing protein 1
  • FLJ21213
  • FLJ21879
  • FLJ41901
  • NBLA04196
  • WUGSC:H_GS542D18.2


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, TCS
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC

Publications for CASD1 Antibody (NBP1-69609) (0)

There are no publications for CASD1 Antibody (NBP1-69609).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CASD1 Antibody (NBP1-69609) (0)

There are no reviews for CASD1 Antibody (NBP1-69609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CASD1 Antibody (NBP1-69609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CASD1 Products

Bioinformatics Tool for CASD1 Antibody (NBP1-69609)

Discover related pathways, diseases and genes to CASD1 Antibody (NBP1-69609). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CASD1 Antibody (NBP1-69609)

Discover more about diseases related to CASD1 Antibody (NBP1-69609).

Pathways for CASD1 Antibody (NBP1-69609)

View related products by pathway.

PTMs for CASD1 Antibody (NBP1-69609)

Learn more about PTMs related to CASD1 Antibody (NBP1-69609).

Blogs on CASD1

There are no specific blogs for CASD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CASD1 Antibody and receive a gift card or discount.


Gene Symbol CASD1