SLC38A6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC38A6 Antibody [NBP1-81010] - Immunofluorescent staining of human cell line U-251 MG shows localization to microtubules & cell junctions.
Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human cerebral cortex shows moderate membranous positivity in neurons.
Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human liver shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human small intestine shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC38A6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA
Specificity
Specificity of human SLC38A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC38A6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. IHC reported in the literature (PMID: 24752331).
Control Peptide
SLC38A6 Protein (NBP1-81010PEP)
Publications
Read Publication using
NBP1-81010 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24752331).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC38A6 Antibody

  • N system amino acid transporter NAT-1
  • SNAT6
  • solute carrier family 38, member 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-326
Species: All-NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB120-11929
Species: Hu, Mu
Applications: WB, Flow
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt, V-Vi
Applications: WB, IHC, IHC-P
NBP2-38594
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for SLC38A6 Antibody (NBP1-81010)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for SLC38A6 Antibody (NBP1-81010) (0)

There are no reviews for SLC38A6 Antibody (NBP1-81010). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC38A6 Antibody (NBP1-81010) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC38A6 Products

Bioinformatics Tool for SLC38A6 Antibody (NBP1-81010)

Discover related pathways, diseases and genes to SLC38A6 Antibody (NBP1-81010). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC38A6 Antibody (NBP1-81010)

Discover more about diseases related to SLC38A6 Antibody (NBP1-81010).
 

Pathways for SLC38A6 Antibody (NBP1-81010)

View related products by pathway.

Blogs on SLC38A6

There are no specific blogs for SLC38A6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC38A6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC38A6
Entrez