Reactivity | Hu, MuSpecies Glossary |
Applications | ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SLC38A6 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. IHC reported in the literature (PMID: 24752331). |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-81010 | Applications | Species |
---|---|---|
Bagchi S, Baomar HA, Al-Walai S et al. Histological Analysis of SLC38A6 (SNAT6) Expression in Mouse Brain Shows Selective Expression in Excitatory Neurons with High Expression in the Synapses. PLoS One 2014-01-01 [PMID: 24752331] (IF/IHC, Mouse) | IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Diseases for SLC38A6 Antibody (NBP1-81010)Discover more about diseases related to SLC38A6 Antibody (NBP1-81010).
| Pathways for SLC38A6 Antibody (NBP1-81010)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.