CART1 Antibody (2A10)

Images

 
Western Blot: CART1 Antibody (2A10) [H00008092-M02] - CART1 monoclonal antibody (M02), clone 2A10. Analysis of CART1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: CART1 Antibody (2A10) [H00008092-M02] - Analysis of monoclonal antibody to ALX1 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: CART1 Antibody (2A10) [H00008092-M02] - Detection limit for recombinant GST tagged CART1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CART1 Antibody (2A10) Summary

Immunogen
CART1 (NP_008913 198 a.a. - 306 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSS
Specificity
CART1 - cartilage paired-class homeoprotein 1 (2A10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ALX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CART1 Antibody (2A10)

  • ALX homeobox 1
  • CART-1
  • CART1ALX homeobox protein 1
  • Cartilage homeoprotein 1
  • cartilage paired-class homeoprotein 1
  • FND3

Background

The specific function of this gene has yet to be determined in humans; however, in rodents, it is necessary for survival of the forebrain mesenchyme and may also be involved in development of the cervix. Mutations in the mouse gene lead to neural tube defects such as acrania and meroanencephaly. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45490
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
H00000257-Q01
Species: Hu
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-136
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56177
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2420
Species: Hu
Applications: WB, IHC
AF2050
Species: Hu
Applications: WB, IHC
NBP2-13816
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow

Publications for CART1 Antibody (H00008092-M02) (0)

There are no publications for CART1 Antibody (H00008092-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CART1 Antibody (H00008092-M02) (0)

There are no reviews for CART1 Antibody (H00008092-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CART1 Antibody (H00008092-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CART1 Products

Bioinformatics Tool for CART1 Antibody (H00008092-M02)

Discover related pathways, diseases and genes to CART1 Antibody (H00008092-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CART1 Antibody (H00008092-M02)

Discover more about diseases related to CART1 Antibody (H00008092-M02).
 

Pathways for CART1 Antibody (H00008092-M02)

View related products by pathway.

PTMs for CART1 Antibody (H00008092-M02)

Learn more about PTMs related to CART1 Antibody (H00008092-M02).

Blogs on CART1

There are no specific blogs for CART1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CART1 Antibody (2A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol ALX1
Entrez
Uniprot