CARD12 Antibody

Images

 
Immunohistochemistry: CARD12 Antibody [NBP2-13660] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CARD12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TDSLGNLKNLTKLIMDNIKMNEEDAIKLAEGLKNLKKMCLFHLTHLSDIG EGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKILAQNLHNLVKLSILDL SENYLEKDGNEALHELIDRMNVLEQLTALMLPWG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLRC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CARD12 Protein (NBP2-13660PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CARD12 Antibody

  • CARD12leucine rich repeat and CARD domaincontaining 4
  • caspase recruitment domain family, member 12
  • Caspase recruitment domain-containing protein 12
  • Clan protein
  • CLAN1ipaf
  • CLANCARD, LRR, and NACHT-containing protein
  • CLR2.1
  • Ice protease-activating factor
  • Ipaf
  • NLR family, CARD domain containing 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
H00009447-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB829
Species: Hu
Applications: WB, IHC
NBP2-24787
Species: Hu, Mu, Ca
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-CS, Flow-IC
NB100-56152
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
AF6567
Species: Hu, Mu
Applications: WB, IHC

Publications for CARD12 Antibody (NBP2-13660) (0)

There are no publications for CARD12 Antibody (NBP2-13660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CARD12 Antibody (NBP2-13660) (0)

There are no reviews for CARD12 Antibody (NBP2-13660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CARD12 Antibody (NBP2-13660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CARD12 Products

Bioinformatics Tool for CARD12 Antibody (NBP2-13660)

Discover related pathways, diseases and genes to CARD12 Antibody (NBP2-13660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CARD12 Antibody (NBP2-13660)

Discover more about diseases related to CARD12 Antibody (NBP2-13660).
 

Pathways for CARD12 Antibody (NBP2-13660)

View related products by pathway.

PTMs for CARD12 Antibody (NBP2-13660)

Learn more about PTMs related to CARD12 Antibody (NBP2-13660).
 

Research Areas for CARD12 Antibody (NBP2-13660)

Find related products by research area.

Blogs on CARD12

There are no specific blogs for CARD12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CARD12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRC4