Carboxypeptidase B1/CPB1 Recombinant Protein Antigen

Images

 
There are currently no images for Carboxypeptidase B1/CPB1 Protein (NBP2-38549PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Carboxypeptidase B1/CPB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CPB1.

Source: E. coli

Amino Acid Sequence: HGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHSTVDFRVKAEDTVTVENVLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CPB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38549.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Carboxypeptidase B1/CPB1 Recombinant Protein Antigen

  • carboxypeptidase B
  • carboxypeptidase B1 (tissue)
  • Carboxypeptidase B1
  • CPB
  • CPB1
  • DKFZp779K1333
  • EC 3.4.17
  • EC 3.4.17.2
  • Pancreas-specific protein
  • PASP
  • PCPB
  • procarboxypeptidase B

Background

Carboxypeptidase catalyzes the hydrolysis of the basic amino acids lysine, arginine and ornithine from the C-terminal position in polypeptides. It occurs as a zymogen in the pancreas in most vertebrates. This reagent is suited to enable an immunological appraoch to the study of protein and peptide structure.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

M6000B
Species: Mu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
AF226
Species: Hu
Applications: WB
AF6036
Species: Hu
Applications: IHC, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF1148
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
NBP2-52559
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NB600-533
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP3-42341
Species: Hu, Po, Rt
Applications: IHC,  IHC-P, WB
NBP1-32660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89278
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DY4517-05
Species: Mu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF1267
Species: Hu
Applications: IP, Neut, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP2-38549PEP
Species: Hu
Applications: AC

Publications for Carboxypeptidase B1/CPB1 Protein (NBP2-38549PEP) (0)

There are no publications for Carboxypeptidase B1/CPB1 Protein (NBP2-38549PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carboxypeptidase B1/CPB1 Protein (NBP2-38549PEP) (0)

There are no reviews for Carboxypeptidase B1/CPB1 Protein (NBP2-38549PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Carboxypeptidase B1/CPB1 Protein (NBP2-38549PEP). (Showing 1 - 2 of 2 FAQ).

  1. I use porcine carboxypeptidase B (CPB) in my fermentation process. I want to detect the residual CPB in my finished product preferably by ELISA/western blot. How will antibody pairs from Novus Biologics help me do that? Is a colorimetric assay possible with the antibody pair?
    • Any detection system can be employed when using the antibody pairs. The detection system will depend on the secondary used against the detection primary antibody from the pair, and the conjugate on the secondary antibody. The pair will work effectively in capturing the protein of interest, and subsequently detecting it with the second antibody in the pair for ELISA. This pair is not evaluated in Western Blot directly, but there Novus carries similar primary antibodies that we have that are validated in that application.
  2. I am trying to establish ELISA detection for carboxy peptidase. I am using a rat recombinant carboxypeptodase b from Roche diagnostics (cat no.03358682103). Can you please suggest the suitable kit .
    • Here is a link to our CPB1 products. H00001360-AP21 and H00001360-AP11 may suit your needs.

Additional Carboxypeptidase B1/CPB1 Products

Blogs on Carboxypeptidase B1/CPB1

There are no specific blogs for Carboxypeptidase B1/CPB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Carboxypeptidase B1/CPB1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CPB1