Carbonic Anhydrase XIII/CA13 Antibody - BSA Free

Western Blot: Carbonic Anhydrase XIII/CA13 Antibody [NBP2-87124] - WB Suggested Anti-CA13 Antibody. Titration: 1.0 ug/ml. Positive Control: THP-1 Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Carbonic Anhydrase XIII/CA13 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Carbonic Anhydrase XIII/CA13 Antibody - BSA Free (NBP2-87124) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Carbonic Anhydrase XIII/CA13. Peptide sequence: HWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGH The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CA13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Carbonic Anhydrase XIII/CA13 Antibody - BSA Free

• CA13
• carbonic anhydrase 13
• Carbonic Anhydrase XIII
• carbonic anhydrase XIIICarbonate dehydratase XIII
• CAXIII
• CA-XIII
• EC 4.2.1.1
• FLJ37995
• MGC59868

Background

Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family, see MIM 114800.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CA13