Carbonic Anhydrase VII/CA7 Antibody

Images

 
Western Blot: CA7 Antibody [NBP1-68888] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carbonic Anhydrase VII/CA7 Antibody Summary

Immunogen
Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CA7 and was validated on Western blot.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Carbonic Anhydrase VII/CA7 Antibody

  • CA7
  • Carbonate dehydratase VII
  • carbonic anhydrase 7
  • Carbonic Anhydrase VII
  • carbonic anhydrase VIICAVII
  • carbonic dehydratase VII
  • CA-VII
  • EC 4.2.1.1

Background

Carbonic anhydrases are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. The cytosolic protein encoded by this gene is predominantly expressed in the salivary glands. Alternative splicing in the coding region results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2939
Species: Hu
Applications: WB, Simple Western, IP
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
796-IC
Species: Mu
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NB100-56552
Species: Hu
Applications: WB
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-68888
Species: Hu
Applications: WB

Publications for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888) (0)

There are no publications for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888) (0)

There are no reviews for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carbonic Anhydrase VII/CA7 Products

Bioinformatics Tool for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888)

Discover related pathways, diseases and genes to Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888)

Discover more about diseases related to Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888).
 

Pathways for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888)

View related products by pathway.

Research Areas for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888)

Find related products by research area.

Blogs on Carbonic Anhydrase VII/CA7

There are no specific blogs for Carbonic Anhydrase VII/CA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase VII/CA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CA7
Entrez
Uniprot