Carbonic Anhydrase VII/CA7 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CA7 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Carbonic Anhydrase VII/CA7 Antibody - BSA Free
Background
Carbonic anhydrases are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. The cytosolic protein encoded by this gene is predominantly expressed in the salivary glands. Alternative splicing in the coding region results in multiple transcript variants encoding different isoforms.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PLA, Simple Western, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: ELISA
Publications for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888) (0)
There are no publications for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888) (0)
There are no reviews for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Carbonic Anhydrase VII/CA7 Products
Research Areas for Carbonic Anhydrase VII/CA7 Antibody (NBP1-68888)
Find related products by research area.
|
Blogs on Carbonic Anhydrase VII/CA7