Carbonic Anhydrase IV/CA4 Antibody

Western Blot: Carbonic Anhydrase IV/CA4 Antibody [H00000762-B02P] - Analysis of CA4 expression in A-431.

Western Blot: Carbonic Anhydrase IV/CA4 Antibody [H00000762-B02P] - Analysis of CA4 expression in transfected 293T cell line by CA4 polyclonal antibody. Lane 1: CA4 transfected lysate(34.32 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

Carbonic Anhydrase IV/CA4 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CA4 (NP_000708.1, 1 a.a. - 312 a.a.) full-length human protein. MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR
• Specificity: CA4 - carbonic anhydrase IV,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CA4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Carbonic Anhydrase IV/CA4 Antibody

• CA4
• CAIV
• CA-IV
• Car4
• Carbonate dehydratase IV
• carbonic anhydrase 4
• Carbonic Anhydrase IV
• carbonic anhydrase IVRP17
• carbonic dehydratase IV
• EC 4.2.1.1
• retinitis pigmentosa 17 (autosomal dominant)
• RP17

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Its exact function is not known; however, it may have a role in inherited renal abnormalities of bicarbonate transport. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Carbonic Anhydrase IV/CA4 Antibody (H00000762-B02P)(1)

Publication using H00000762-B02P

• McGinley C, Bishop DJ. Rest interval duration does not influence adaptations in acid/base transport proteins following 10 weeks of sprint-interval training in active women. Am J Physiol Regul Integr Comp Physiol 2017-02-01 [PMID: 28148492]

Bioinformatics

• Gene Symbol: CA4
• Entrez:
  • 762(Human)
• Uniprot:
  • NP_000708.1(Human)