Carbonic Anhydrase III/CA3 Recombinant Protein Antigen

Images

 
There are currently no images for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Carbonic Anhydrase III/CA3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CA3.

Source: E. coli

Amino Acid Sequence: YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88227.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Carbonic Anhydrase III/CA3 Recombinant Protein Antigen

  • CA3
  • CAIII
  • CA-III
  • Car3
  • Carbonate dehydratase III
  • carbonic anhydrase 3
  • Carbonic Anhydrase III
  • carbonic anhydrase III, muscle specific
  • EC 4.2.1.1

Background

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encode carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB600-919
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF2414
Species: Mu
Applications: IHC, IP, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB2358
Species: Hu, Mu
Applications: ICC, IHC
NB120-11427
Species: Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NB300-143
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP) (0)

There are no publications for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP) (0)

There are no reviews for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carbonic Anhydrase III/CA3 Products

Research Areas for Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP)

Find related products by research area.

Blogs on Carbonic Anhydrase III/CA3

There are no specific blogs for Carbonic Anhydrase III/CA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Carbonic Anhydrase III/CA3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CA3