Carbohydrate Sulfotransferase 3/CHST3 Antibody

Images

 
Western Blot: Carbohydrate Sulfotransferase 3/CHST3 Antibody [NBP2-57128] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: Carbohydrate Sulfotransferase 3/CHST3 Antibody [NBP2-57128] - Staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carbohydrate Sulfotransferase 3/CHST3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRL
Specificity
Specificity of human Carbohydrate Sulfotransferase 3/CHST3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHST3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 84%, Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Carbohydrate Sulfotransferase 3/CHST3 Antibody

  • C6ST1
  • C6ST-1
  • C6ST1HSD
  • C6STEC 2.8.2.17
  • carbohydrate (chondroitin 6) sulfotransferase 3
  • Carbohydrate Sulfotransferase 3
  • Chondroitin 6-O-sulfotransferase 1
  • Chondroitin 6-sulfotransferase
  • CHST3
  • EC 2.8.2
  • Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0
  • GST-0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85368
Species: Hu, RM
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB8630
Species: Hu
Applications: WB, IHC
NBP1-59531
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Mk, Sh
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB3650
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-26116
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-32001
Species: Hu, Mu
Applications: WB, IHC, IHC-P
7270-IL/CF
Species: Hu

Publications for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-57128) (0)

There are no publications for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-57128).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-57128) (0)

There are no reviews for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-57128). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-57128) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Carbohydrate Sulfotransferase 3/CHST3 Products

Bioinformatics Tool for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-57128)

Discover related pathways, diseases and genes to Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-57128). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-57128)

Discover more about diseases related to Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-57128).
 

Pathways for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-57128)

View related products by pathway.

Blogs on Carbohydrate Sulfotransferase 3/CHST3

There are no specific blogs for Carbohydrate Sulfotransferase 3/CHST3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbohydrate Sulfotransferase 3/CHST3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHST3