Carbohydrate Sulfotransferase 3/CHST3 Antibody

Images

 
Immunohistochemistry: Carbohydrate sulfotransferase 3 Antibody [NBP2-31611] - Staining of human placenta shows strong cytoplasmic positivity in decidua cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carbohydrate Sulfotransferase 3/CHST3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHST3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Carbohydrate Sulfotransferase 3/CHST3 Protein (NBP2-31611PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carbohydrate Sulfotransferase 3/CHST3 Antibody

  • C6ST1
  • C6ST-1
  • C6ST1HSD
  • C6STEC 2.8.2.17
  • carbohydrate (chondroitin 6) sulfotransferase 3
  • Carbohydrate Sulfotransferase 3
  • Chondroitin 6-O-sulfotransferase 1
  • Chondroitin 6-sulfotransferase
  • CHST3
  • EC 2.8.2
  • Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0
  • GST-0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB8630
Species: Hu
Applications: WB, IHC
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB3650
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-31611
Species: Hu
Applications: IHC, IHC-P

Publications for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-31611) (0)

There are no publications for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-31611).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-31611) (0)

There are no reviews for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-31611). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-31611) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carbohydrate Sulfotransferase 3/CHST3 Products

Bioinformatics Tool for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-31611)

Discover related pathways, diseases and genes to Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-31611). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-31611)

Discover more about diseases related to Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-31611).
 

Pathways for Carbohydrate Sulfotransferase 3/CHST3 Antibody (NBP2-31611)

View related products by pathway.

Blogs on Carbohydrate Sulfotransferase 3/CHST3

There are no specific blogs for Carbohydrate Sulfotransferase 3/CHST3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbohydrate Sulfotransferase 3/CHST3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHST3
Entrez
Uniprot