CaMKK2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CaMKK2 Antibody [NBP1-86651] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CaMKK2 Antibody [NBP1-86651] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: CaMKK2 Antibody [NBP1-86651] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: CaMKK2 Antibody [NBP1-86651] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CaMKK2 Antibody [NBP1-86651] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in human cerebral cortex tissue.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CaMKK2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAMKK2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CaMKK2 Protein (NBP1-86651PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CaMKK2 Antibody - BSA Free

• calcium/calmodulin-dependent protein kinase kinase 2
• calcium/calmodulin-dependent protein kinase kinase 2, beta
• Calcium/calmodulin-dependent protein kinase kinase beta
• CaM-kinase kinase 2
• CaM-kinase kinase beta
• CaMKK 2
• CaM-KK 2
• CAMKK beta protein
• CaMKK beta
• CaM-KK beta
• CAMKK
• CaMKK2
• CAMKKB
• CAMKKBCaMKK 2
• EC 2.7.11
• EC 2.7.11.17
• KIAA0787
• KIAA0787calcium/calmodulin-dependent protein kinase beta
• MGC15254

Background

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CaMKK2 Antibody (NBP1-86651)(3)

Publications using NBP1-86651

• Lim, CM;González Díaz, A;Fuxreiter, M;Pun, FW;Zhavoronkov, A;Vendruscolo, M; Multiomic prediction of therapeutic targets for human diseases associated with protein phase separation Proceedings of the National Academy of Sciences of the United States of America 2023-10-03 [PMID: 37774095]
• Dilley J, Seetharam A, Ding X et al. CAMKK2 is upregulated in primary human osteoarthritis and its inhibition protects against chondrocyte apoptosis Osteoarthritis Cartilage. 2023-02-27 [PMID: 36858195] (IHC, WB, Human)
• Massie CE, Lynch A, Ramos-Montoya A et al. The androgen receptor fuels prostate cancer by regulating central metabolism and biosynthesis. EMBO J 2011-05-01 [PMID: 21602788]

Bioinformatics

• Gene Symbol: CAMKK2