Calmodulin 2 Antibody

Images

 
Western Blot: Calmodulin 2 Antibody [H00000805-B01P] - Analysis of CALM2 expression in transfected 293T cell line by CALM2 polyclonal antibody. Lane 1: CALM2 transfected lysate(16.5 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Calmodulin 2 Antibody Summary

Immunogen
CALM2 (AAH03354, 1 a.a. - 149 a.a.) full-length human protein. MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKVKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CALM2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calmodulin 2 Antibody

  • CALM
  • CALM1
  • CALM3
  • CALML2
  • calmodulin 2 (phosphorylase kinase, delta)
  • calmodulin
  • CAM
  • CAM1
  • CAM2
  • CAM3
  • CAMB
  • CAMC
  • CAMII
  • CAMIII
  • FLJ99410
  • LP7057 protein
  • PHKD
  • PHKD2
  • phosphorylase kinase delta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
H00085366-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000805-B01P
Species: Hu
Applications: WB

Publications for Calmodulin 2 Antibody (H00000805-B01P) (0)

There are no publications for Calmodulin 2 Antibody (H00000805-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calmodulin 2 Antibody (H00000805-B01P) (0)

There are no reviews for Calmodulin 2 Antibody (H00000805-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calmodulin 2 Antibody (H00000805-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calmodulin 2 Products

Bioinformatics Tool for Calmodulin 2 Antibody (H00000805-B01P)

Discover related pathways, diseases and genes to Calmodulin 2 Antibody (H00000805-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calmodulin 2 Antibody (H00000805-B01P)

Discover more about diseases related to Calmodulin 2 Antibody (H00000805-B01P).
 

Pathways for Calmodulin 2 Antibody (H00000805-B01P)

View related products by pathway.

PTMs for Calmodulin 2 Antibody (H00000805-B01P)

Learn more about PTMs related to Calmodulin 2 Antibody (H00000805-B01P).
 

Research Areas for Calmodulin 2 Antibody (H00000805-B01P)

Find related products by research area.

Blogs on Calmodulin 2

There are no specific blogs for Calmodulin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calmodulin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALM2
Uniprot