Calmodulin 2 Antibody - Azide and BSA Free Summary
Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen |
CALM2 (AAH03354, 1 a.a. - 149 a.a.) full-length human protein. MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKVKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
CALM2 |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
It has been used for WB and Functional. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Calmodulin 2 Antibody - Azide and BSA Free
Background
Calmodulin mediates the control of a large number of enzymes and other proteins by Ca(2+). Among the enzymesto be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases. Together withCEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression throughcytokinesis
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, KD, WB
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Publications for Calmodulin 2 Antibody (H00000805-B01P) (0)
There are no publications for Calmodulin 2 Antibody (H00000805-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Calmodulin 2 Antibody (H00000805-B01P) (0)
There are no reviews for Calmodulin 2 Antibody (H00000805-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Calmodulin 2 Antibody (H00000805-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Calmodulin 2 Products
Research Areas for Calmodulin 2 Antibody (H00000805-B01P)
Find related products by research area.
|
Blogs on Calmodulin 2