We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Calcium-sensing R/CaSR Recombinant Protein Antigen

Images

 
There are currently no images for Calcium-sensing R/CaSR Protein (NBP2-38622PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Calcium-sensing R/CaSR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CASR.

Source: E. coli

Amino Acid Sequence: ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CASR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38622.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Calcium-sensing R/CaSR Recombinant Protein Antigen

  • calcium-sensing receptor
  • CAR
  • CaSR
  • EIG8
  • extracellular calcium-sensing receptor
  • FHH
  • FIH
  • GPRC2A
  • GPRC2AHHC
  • HHC1
  • hypocalciuric hypercalcemia 1
  • NSHPT
  • parathyroid Ca(2+)-sensing receptor 1
  • Parathyroid cell calcium-sensing receptor
  • PCaR1
  • PCAR1MGC138441

Background

Calcium-Sensing Receptor (CaSR) is a member of the G protein-coupled receptor family. CaSR is an integral membrane protein that senses changes in the extracellular concentration of calcium ions and controls the release of parathyroid hormone. The activity of the calcium-sensing receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system.

Mutations that inactivate CaSR lead to familial hypocalciuric hypercalcemia, whereas mutations that activate CaSR cause autosomal dominant hypocalcemia. Calcium-Sensing Receptor antibodies are useful tools for parathyroid studies and research on cellular calcium homeostasis regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7665
Species: Hu
Applications: IHC, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
AF7356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF2654
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-01800
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
H00001594-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-66778
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
AF1106
Species: Hu
Applications: IP, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB

Publications for Calcium-sensing R/CaSR Protein (NBP2-38622PEP) (0)

There are no publications for Calcium-sensing R/CaSR Protein (NBP2-38622PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcium-sensing R/CaSR Protein (NBP2-38622PEP) (0)

There are no reviews for Calcium-sensing R/CaSR Protein (NBP2-38622PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Calcium-sensing R/CaSR Protein (NBP2-38622PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Calcium-sensing R/CaSR Products

Research Areas for Calcium-sensing R/CaSR Protein (NBP2-38622PEP)

Find related products by research area.

Blogs on Calcium-sensing R/CaSR

There are no specific blogs for Calcium-sensing R/CaSR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Calcium-sensing R/CaSR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CASR