Calcium Activated Nucleotidase 1/CANT1 Antibody


Immunohistochemistry-Paraffin: Calcium Activated Nucleotidase 1/CANT1 Antibody [NBP1-87083] - Staining of human rectum shows high expression.
Immunohistochemistry-Paraffin: Calcium Activated Nucleotidase 1/CANT1 Antibody [NBP1-87083] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Calcium Activated Nucleotidase 1/CANT1 Antibody [NBP1-87083] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Calcium Activated Nucleotidase 1/CANT1 Antibody [NBP1-87083] - Staining in human rectum and pancreas tissues using anti-CANT1 antibody. Corresponding CANT1 RNA-seq data are presented for more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

Calcium Activated Nucleotidase 1/CANT1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TTTTGDVVNENPEWVKVVGYKGSVDHENWVSNYNALRAAAGIQPPGYLIHESACWSDTLQRWFFLPRRASQERYSEKDD
Specificity of human Calcium Activated Nucleotidase 1/CANT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Calcium Activated Nucleotidase 1/CANT1 Protein (NBP1-87083PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Calcium Activated Nucleotidase 1/CANT1 Antibody

  • Apyrase homolog
  • calcium activated nucleotidase 1
  • CANT1
  • DBQD
  • EC
  • Putative MAPK-activating protein PM09
  • Putative NF-kappa-B-activating protein 107
  • SCAN1
  • SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase
  • SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification
  • soluble Ca-activated nucleotidase, isozyme 1
  • soluble calcium-activated nucleotidase 1
  • soluble calcium-activated nucleotidase SCAN-1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, ICC
Species: Hu
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083) (0)

There are no publications for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083) (0)

There are no reviews for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Calcium Activated Nucleotidase 1/CANT1 Products

Bioinformatics Tool for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083)

Discover related pathways, diseases and genes to Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083)

Discover more about diseases related to Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083).

Pathways for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083)

View related products by pathway.

Research Areas for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083)

Find related products by research area.

Blogs on Calcium Activated Nucleotidase 1/CANT1

There are no specific blogs for Calcium Activated Nucleotidase 1/CANT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Calcium Activated Nucleotidase 1/CANT1 Antibody and receive a gift card or discount.


Gene Symbol CANT1