Calcium Activated Nucleotidase 1/CANT1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TTTTGDVVNENPEWVKVVGYKGSVDHENWVSNYNALRAAAGIQPPGYLIHESACWSDTLQRWFFLPRRASQERYSEKDD |
| Predicted Species |
Mouse (91%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CANT1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (84%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Calcium Activated Nucleotidase 1/CANT1 Antibody - BSA Free
Background
Calcium-activated nucleotidase-1 (EC 3.6.1.6) is an extracellular protein that functions as a nucleotide tri- anddiphosphatase (Smith et al., 2002 (PubMed 12234496)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, Simple Western, WB
Species: Bv, Hu
Applications: DB, ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Publications for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083) (0)
There are no publications for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083) (0)
There are no reviews for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Calcium Activated Nucleotidase 1/CANT1 Products
Research Areas for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87083)
Find related products by research area.
|
Blogs on Calcium Activated Nucleotidase 1/CANT1