CD39L4/ENTPD5 Antibody

Images

 
Western Blot: CD39L4/ENTPD5 Antibody [NBP1-85751] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver
Immunocytochemistry/ Immunofluorescence: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human cell line U-251MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Simple Western: CD39L4/ENTPD5 Antibody [NBP1-85751] - Simple Western lane view shows a specific band for CD39L4/ENTPD5 in 0.2 mg/ml of h. Liver lysate(s). This experiment was performed under reducing conditions using ...read more
Simple Western: CD39L4/ENTPD5 Antibody [NBP1-85751] - Electropherogram image of the corresponding Simple Western lane view. CD39L4/ENTPD5 antibody was used at 1:25 dilution on h. Liver lysate(s) respectively.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD39L4/ENTPD5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ENTPD5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Simple Western 1:25
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.
Control Peptide
CD39L4/ENTPD5 Protein (NBP1-85751PEP)
Publications
Read Publication using NBP1-85751.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (87%). Reactivity reported in scientific literature (PMID: 24435307)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD39L4/ENTPD5 Antibody

  • CD39 antigen-like 4
  • CD39L4
  • CD39L4NTPDase 5
  • CD39-like 4
  • EC 3.6.1
  • EC 3.6.1.42
  • EC 3.6.1.6
  • ectonucleoside triphosphate diphosphohydrolase 5
  • ENTPD5
  • ER-UDPase
  • GDPase ENTPD5
  • Guanosine-diphosphatase ENTPD5
  • MGC163357
  • MGC163359
  • NTPDase 5
  • NTPDase-5
  • Nucleoside diphosphatase
  • Pcph proto-oncogene protein
  • PCPH
  • proto-oncogene CPH
  • UDPase ENTPD5
  • Uridine-diphosphatase ENTPD5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-80533
Species: Mu
Applications: WB
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
AF4399
Species: Hu
Applications: WB, IP
NBP1-90071
Species: Hu, Mu, Po, Eq
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-81510
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF4400
Species: Hu
Applications: WB, IHC
NBP1-85752
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85751
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for CD39L4/ENTPD5 Antibody (NBP1-85751)(1)

Reviews for CD39L4/ENTPD5 Antibody (NBP1-85751) (0)

There are no reviews for CD39L4/ENTPD5 Antibody (NBP1-85751). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CD39L4/ENTPD5 Antibody (NBP1-85751) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD39L4/ENTPD5 Products

Bioinformatics Tool for CD39L4/ENTPD5 Antibody (NBP1-85751)

Discover related pathways, diseases and genes to CD39L4/ENTPD5 Antibody (NBP1-85751). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD39L4/ENTPD5 Antibody (NBP1-85751)

Discover more about diseases related to CD39L4/ENTPD5 Antibody (NBP1-85751).
 

Pathways for CD39L4/ENTPD5 Antibody (NBP1-85751)

View related products by pathway.

PTMs for CD39L4/ENTPD5 Antibody (NBP1-85751)

Learn more about PTMs related to CD39L4/ENTPD5 Antibody (NBP1-85751).
 

Research Areas for CD39L4/ENTPD5 Antibody (NBP1-85751)

Find related products by research area.

Blogs on CD39L4/ENTPD5

There are no specific blogs for CD39L4/ENTPD5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD39L4/ENTPD5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ENTPD5
Entrez