Calcium Activated Nucleotidase 1/CANT1 Antibody

Images

 
Western Blot: Calcium Activated Nucleotidase 1/CANT1 Antibody [NBP1-87081] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Calcium Activated Nucleotidase 1/CANT1 Antibody [NBP1-87081] - Staining of human colon shows strong cytoplasmic positivity, with a granular pattern, in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calcium Activated Nucleotidase 1/CANT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CANT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Calcium Activated Nucleotidase 1/CANT1 Protein (NBP1-87081PEP)
Publications
Read Publication using NBP1-87081.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23436904)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calcium Activated Nucleotidase 1/CANT1 Antibody

  • Apyrase homolog
  • calcium activated nucleotidase 1
  • CANT1
  • DBQD
  • EC 3.6.1.6
  • Putative MAPK-activating protein PM09
  • Putative NF-kappa-B-activating protein 107
  • SCAN1
  • SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase
  • SHAPY
  • SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification
  • soluble Ca-activated nucleotidase, isozyme 1
  • soluble calcium-activated nucleotidase 1
  • soluble calcium-activated nucleotidase SCAN-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81642
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-13283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-534
Species: Hu
Applications: WB, IP
H00007150-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7450
Species: Hu
Applications: IHC
NBP1-94712
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7028
Species: Mu, Rt
Applications: WB, ICC
NBL1-12154
Species: Hu
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP1-85751
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46781
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-55414
Species: Hu
Applications: WB, ICC/IF
NBP1-87081
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87081)(1)

Reviews for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87081) (0)

There are no reviews for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87081). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87081) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calcium Activated Nucleotidase 1/CANT1 Products

Bioinformatics Tool for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87081)

Discover related pathways, diseases and genes to Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87081). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87081)

Discover more about diseases related to Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87081).
 

Pathways for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87081)

View related products by pathway.

Research Areas for Calcium Activated Nucleotidase 1/CANT1 Antibody (NBP1-87081)

Find related products by research area.

Blogs on Calcium Activated Nucleotidase 1/CANT1

There are no specific blogs for Calcium Activated Nucleotidase 1/CANT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calcium Activated Nucleotidase 1/CANT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CANT1
Entrez