Calcitonin R Antibody

Images

 
Western Blot: Calcitonin receptor Antibody [NBP1-88041] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Calcitonin receptor Antibody [NBP1-88041] - Staining of human colon shows strong cytoplasmic positivity(granular pattern) in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calcitonin R Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALCR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Calcitonin R Protein (NBP1-88041PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calcitonin R Antibody

  • Calcitonin R
  • calcitonin receptor
  • CalcitoninR
  • CALCR
  • CRT
  • CTR
  • CT-R
  • CTR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB100-402
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for Calcitonin R Antibody (NBP1-88041) (0)

There are no publications for Calcitonin R Antibody (NBP1-88041).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcitonin R Antibody (NBP1-88041) (0)

There are no reviews for Calcitonin R Antibody (NBP1-88041). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calcitonin R Antibody (NBP1-88041) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calcitonin R Products

Bioinformatics Tool for Calcitonin R Antibody (NBP1-88041)

Discover related pathways, diseases and genes to Calcitonin R Antibody (NBP1-88041). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calcitonin R Antibody (NBP1-88041)

Discover more about diseases related to Calcitonin R Antibody (NBP1-88041).
 

Pathways for Calcitonin R Antibody (NBP1-88041)

View related products by pathway.

Research Areas for Calcitonin R Antibody (NBP1-88041)

Find related products by research area.

Blogs on Calcitonin R

There are no specific blogs for Calcitonin R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calcitonin R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALCR
Entrez
Uniprot