Calbindin D-28K Antibody

Western Blot: Calbindin D-28K Antibody [H00000793-D01P] - Analysis of CALB1 expression in transfected 293T cell line by CALB1 rabbit polyclonal antibody.Lane 1: CALB1 transfected lysate(30.00 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: Calbindin D-28K Antibody [H00000793-D01P] - Analysis of rabbit antibody to CALB1 on HeLa cell. Antibody concentration 10 ug/ml.

Product Discontinued

Calbindin D-28K Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CALB1 (NP_004920.1, 1 a.a. - 261 a.a.) full-length human protein. MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN
• Specificity: CALB1 - calbindin 1, 28kDa,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALB1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calbindin D-28K Antibody

• CAB27
• CALB
• calbindin 1, (28kD)
• calbindin 1, 28kDa
• Calbindin D28
• calbindin
• D-28K
• RTVL-H protein
• Vitamin D-dependent calcium-binding protein, avian-type

Background

Calbindin is a calcium-binding protein belonging to the troponin C superfamily. It was originally described as a 27-kD protein induced by vitamin D in the duodenum of the chick. In the brain, its synthesis is independent of vitamin-D-derived hormones. Calbindin contains 4 active calcium-binding domains, and 2 modified domains that presumably have lost their calcium-binding capacity. The neurons in brains of patients with Huntington disease are calbindin-depleted. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Calbindin D-28K Antibody (H00000793-D01P). (Showing 1 - 1 of 1 FAQ).

1. I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?
   • This link will take you to all of our alpha7 nicotinic cholingergic receptor antibodies currently available for purchase. Please see the following link for our Calbinin D28K antibodies reactive against mouse and human. We currently do not have any Parvalbumin antibodies that have been tested in mouse. I would like to introduce you to our Innovators Reward Program. Try our primary antibodies in an untested species or application, without the financial risk of failure. The pricing and availability of our products depends on your country.

Bioinformatics

• Gene Symbol: CALB1
• Entrez:
  • 793(Human)
• Uniprot:
  • NP_004920.1(Human)