Cadherin-17 Antibody (3H2)

Images

 
Immunohistochemistry-Paraffin: Cadherin-17 Antibody (3H2) [H00001015-M03] - Analysis of monoclonal antibody to CDH17 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml
ELISA: Cadherin-17 Antibody (3H2) [H00001015-M03] - Detection limit for recombinant GST tagged CDH17 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
3H2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cadherin-17 Antibody (3H2) Summary

Immunogen
CDH17 (NP_004054, 24 a.a. - 131 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY
Specificity
CDH17 - cadherin 17, LI cadherin (liver-intestine) (3H2)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDH17
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P.
Publications
Read Publication using H00001015-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cadherin-17 Antibody (3H2)

  • cadherin 17, LI cadherin (liver-intestine)
  • cadherin
  • cadherin-16
  • Cadherin17
  • Cadherin-17
  • CDH16
  • CDH17
  • FLJ26931
  • HPT-1 cadherin
  • HPT1
  • HPT-1
  • human intestinal peptide-associated transporter HPT-1
  • human peptide transporter 1
  • Intestinal peptide-associated transporter HPT-1
  • LI cadherin
  • LI-cadherin
  • Liver-intestine cadherin
  • MGC138218
  • MGC142024

Background

This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34200
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Cadherin-17 Antibody (H00001015-M03)(1)


Reviews for Cadherin-17 Antibody (H00001015-M03) (0)

There are no reviews for Cadherin-17 Antibody (H00001015-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cadherin-17 Antibody (H00001015-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cadherin-17 Products

Bioinformatics Tool for Cadherin-17 Antibody (H00001015-M03)

Discover related pathways, diseases and genes to Cadherin-17 Antibody (H00001015-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-17 Antibody (H00001015-M03)

Discover more about diseases related to Cadherin-17 Antibody (H00001015-M03).
 

Pathways for Cadherin-17 Antibody (H00001015-M03)

View related products by pathway.

PTMs for Cadherin-17 Antibody (H00001015-M03)

Learn more about PTMs related to Cadherin-17 Antibody (H00001015-M03).
 

Research Areas for Cadherin-17 Antibody (H00001015-M03)

Find related products by research area.

Blogs on Cadherin-17

There are no specific blogs for Cadherin-17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cadherin-17 Antibody (3H2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH17
Entrez
Uniprot