CACNG4 Antibody


Immunocytochemistry/ Immunofluorescence: CACNG4 Antibody [NBP2-55863] - Staining of human cell line SH-SY5Y shows localization to cytosol.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

CACNG4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLSREPLKVTTAASYSPDQEASFLQVHDFFQQDLKEGFHVSMLNRRTTPV
Specificity of human CACNG4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CACNG4 Recombinant Protein Antigen (NBP2-55863PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for CACNG4 Antibody

  • calcium channel, voltage-dependent, gamma subunit 4
  • MGC11138
  • MGC24983
  • neuronal voltage-gated calcium channel gamma-4 subunit
  • TARP gamma-4
  • transmembrane AMPAR regulatory protein gamma-4
  • voltage-dependent calcium channel gamma-4 subunit


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for CACNG4 Antibody (NBP2-55863) (0)

There are no publications for CACNG4 Antibody (NBP2-55863).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNG4 Antibody (NBP2-55863) (0)

There are no reviews for CACNG4 Antibody (NBP2-55863). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CACNG4 Antibody (NBP2-55863) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CACNG4 Antibody (NBP2-55863)

Discover related pathways, diseases and genes to CACNG4 Antibody (NBP2-55863). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNG4 Antibody (NBP2-55863)

Discover more about diseases related to CACNG4 Antibody (NBP2-55863).

Pathways for CACNG4 Antibody (NBP2-55863)

View related products by pathway.

PTMs for CACNG4 Antibody (NBP2-55863)

Learn more about PTMs related to CACNG4 Antibody (NBP2-55863).

Blogs on CACNG4

There are no specific blogs for CACNG4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CACNG4 Antibody and receive a gift card or discount.


Gene Symbol CACNG4