CACNG4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CACNG4 Antibody [NBP2-55863] - Staining of human cell line SH-SY5Y shows localization to cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CACNG4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CACNG4 Antibody - BSA Free (NBP2-55863) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLSREPLKVTTAASYSPDQEASFLQVHDFFQQDLKEGFHVSMLNRRTTPV
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACNG4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CACNG4 Recombinant Protein Antigen (NBP2-55863PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CACNG4 Antibody - BSA Free

• calcium channel, voltage-dependent, gamma subunit 4
• MGC11138
• MGC24983
• neuronal voltage-gated calcium channel gamma-4 subunit
• TARP gamma-4
• transmembrane AMPAR regulatory protein gamma-4
• voltage-dependent calcium channel gamma-4 subunit

Background

The CACNG4 gene encodes a 327 amino acid long, 36 kDA type I transmembrane AMPA receptor regulatory protein (TARP). The function of this protein is to regulate circulation and channel gating of the AMPA receptors by monitoring rates of activation and deactivation, as well as regulating gate desensitization and resensitization but is not subunit-specific. The CACNG4 gene interacts with CACNG2, CACNG3, CACNG7, AKAP5, and CAMK2D genes in CREB transcription pathways, trafficking of AMPA receptors, MAPK signaling pathways, and cardiac muscle contractions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CACNG4