CACNG3 Antibody (3E4)

Images

 
Western Blot: CACNG3 Antibody (3E4) [H00010368-M01] - CACNG3 monoclonal antibody (M01), clone 3E4. Analysis of CACNG3 expression in PC-12.
Western Blot: CACNG3 Antibody (3E4) [H00010368-M01] - CACNG3 monoclonal antibody (M01), clone 3E4 Analysis of CACNG3 expression in HeLa.
Western Blot: CACNG3 Antibody (3E4) [H00010368-M01] - Analysis of CACNG3 expression in transfected 293T cell line by CACNG3 monoclonal antibody (M01), clone 3E4.Lane 1: CACNG3 transfected lysate(35.5 KDa).Lane 2: ...read more
Sandwich ELISA: CACNG3 Antibody (3E4) [H00010368-M01] - Detection limit for recombinant GST tagged CACNG3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
3E4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CACNG3 Antibody (3E4) Summary

Immunogen
CACNG3 (NP_006530, 199 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPK
Specificity
CACNG3 - calcium channel, voltage-dependent, gamma subunit 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CACNG3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CACNG3 Antibody (3E4)

  • calcium channel, voltage-dependent, gamma subunit 3
  • Neuronal voltage-gated calcium channel gamma-3 subunit
  • voltage-dependent calcium channel gamma-3 subunit
  • voltage-gated calcium channel gamma subunit

Background

L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This protein is similar to the mouse stargazin protein, mutations in which have been associated with absence seizures, also known as petit-mal or spike-wave seizures. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family. This gene is a candidate gene for a familial infantile convulsive disorder with paroxysomal choreoathetosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CACNG3 Antibody (H00010368-M01) (0)

There are no publications for CACNG3 Antibody (H00010368-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNG3 Antibody (H00010368-M01) (0)

There are no reviews for CACNG3 Antibody (H00010368-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNG3 Antibody (H00010368-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CACNG3 Antibody (3E4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNG3
Entrez
OMIM
Uniprot