CACNG1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CACNG1 Antibody [NBP3-35094] - Immunofluorescence analysis of SH-SY5Y cells using CACNG1 Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: CACNG1 Antibody [NBP3-35094] - Immunofluorescence analysis of L929 cells using CACNG1 Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: CACNG1 Antibody [NBP3-35094] - Immunofluorescence analysis of C6 cells using CACNG1 Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CACNG1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CACNG1 Antibody - BSA Free (NBP3-35094) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human CACNG1 (NP_000718.1).
  
  Sequence:
  DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACNG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:500
  • Western Blot 1:1000 - 1:4000
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CACNG1 Antibody - BSA Free

• CACNG1
• CACNLG
• CACNLGDihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma
• calcium channel, voltage-dependent, gamma subunit 1
• L-type calcium channel gamma polypeptide
• neuronal dihydropyridine-sensitive calcium channel gamma subunit
• voltage-dependent calcium channel gamma-1 subunit

Background

L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CACNG1