CACNA2D4 Antibody


Immunohistochemistry-Paraffin: CACNA2D4 Antibody [NBP1-85920] - Staining of human appendix shows strong positivity in a subset of glandular cells.
Immunohistochemistry: CACNA2D4 Antibody [NBP1-85920] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

CACNA2D4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:NDFINIIAYNDYVHYIEPCFKGILVQADRDNREHFKLLVEELMVKGVGVVDQALREAFQILKQFQEAKQGSLCNQAIM
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CACNA2D4 Protein (NBP1-85920PEP)
Read Publication using
NBP1-85920 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23296739).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CACNA2D4 Antibody

  • calcium channel, voltage-dependent, alpha 2/delta subunit 4
  • RCD4
  • voltage-dependent calcium channel subunit alpha-2/delta-4
  • voltage-gated calcium channel alpha(2)delta-4 subunit
  • Voltage-gated calcium channel subunit alpha-2/delta-4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ICC/IF, IHC-Fr
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Bv, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CACNA2D4 Antibody (NBP1-85920)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for CACNA2D4 Antibody (NBP1-85920) (0)

There are no reviews for CACNA2D4 Antibody (NBP1-85920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CACNA2D4 Antibody (NBP1-85920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CACNA2D4 Products

Bioinformatics Tool for CACNA2D4 Antibody (NBP1-85920)

Discover related pathways, diseases and genes to CACNA2D4 Antibody (NBP1-85920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNA2D4 Antibody (NBP1-85920)

Discover more about diseases related to CACNA2D4 Antibody (NBP1-85920).

Pathways for CACNA2D4 Antibody (NBP1-85920)

View related products by pathway.

PTMs for CACNA2D4 Antibody (NBP1-85920)

Learn more about PTMs related to CACNA2D4 Antibody (NBP1-85920).

Research Areas for CACNA2D4 Antibody (NBP1-85920)

Find related products by research area.

Blogs on CACNA2D4

There are no specific blogs for CACNA2D4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CACNA2D4 Antibody and receive a gift card or discount.


Gene Symbol CACNA2D4