CACNA2D4 Antibody

Immunohistochemistry-Paraffin: CACNA2D4 Antibody [NBP1-85920] - Staining of human appendix shows strong positivity in a subset of glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CACNA2D4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NDFINIIAYNDYVHYIEPCFKGILVQADRDNREHFKLLVEELMVKGVGVVDQALREAFQILKQFQEAKQGSLCNQAIM
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACNA2D4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 23296739). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CACNA2D4 Protein (NBP1-85920PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23296739).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CACNA2D4 Antibody

• calcium channel, voltage-dependent, alpha 2/delta subunit 4
• RCD4
• voltage-dependent calcium channel subunit alpha-2/delta-4
• voltage-gated calcium channel alpha(2)delta-4 subunit
• Voltage-gated calcium channel subunit alpha-2/delta-4

Background

FUNCTION: The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Defects in CACNA2D4 are the cause of retinal cone dystrophy 4 (RCD4). RCD4 is characterized by minimal symptoms except for slowly progressive reduction in visual acuity.; Tissue specificity: Predominantly expressed in certain types of endocrine cells. Present in the Paneth cells of the small intestine. Also present in the erythroblasts in the fetal liver, in the cells of the zona reticularis of the adrenal gland and in the basophiles of the pituitary. Present at low level in some brain regions such as the cerebellum (at protein level).; Subcellular location: Membrane; Single-pass type I membrane protein; Miscellaneous: In contrast to CACNA2D1 and CACNA2D2, it does not bind gabapentin, an antiepileptic drug.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CACNA2D4 Antibody (NBP1-85920)(2)

Publications using NBP1-85920

• Xu D, Wang Y, Liu X et al. Development and clinical validation of a novel 9-gene prognostic model based on multi-omics in pancreatic adenocarcinoma Pharmacological research 2020-12-11 [PMID: 33316381] (WB, Human)
• De Sevilla Muller LP, Liu J, Solomon A et al. Expression of Voltage-Gated Calcium Channel alpha2delta4 Subunits in the Mouse and Rat Retina. J Comp Neurol 2013-08-01 [PMID: 23296739] (WB, Human)

Bioinformatics

• Gene Symbol: CACNA2D4