Fbl14 Antibody

Images

 
Western Blot: Fbl14 Antibody [NBP2-33296] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: Fbl14 Antibody [NBP2-33296] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Fbl14 Antibody [NBP2-33296] - Staining of human endometrium shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Fbl14 Antibody [NBP2-33296] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: Fbl14 Antibody [NBP2-33296] - Staining of human tonsil shows weak to moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: Fbl14 Antibody [NBP2-33296] - Staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fbl14 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXL14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Fbl14 Protein (NBP2-33296PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fbl14 Antibody

  • FBL14
  • F-box and leucine-rich repeat protein 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, KD
NBP2-67320
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85920
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28641
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-76914
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
NBP2-30649
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-417
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, PLA, Dual ISH-IHC
NBP2-27293
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-61712
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88178
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for Fbl14 Antibody (NBP2-33296) (0)

There are no publications for Fbl14 Antibody (NBP2-33296).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fbl14 Antibody (NBP2-33296) (0)

There are no reviews for Fbl14 Antibody (NBP2-33296). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Fbl14 Antibody (NBP2-33296) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Fbl14 Products

Bioinformatics Tool for Fbl14 Antibody (NBP2-33296)

Discover related pathways, diseases and genes to Fbl14 Antibody (NBP2-33296). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fbl14 Antibody (NBP2-33296)

Discover more about diseases related to Fbl14 Antibody (NBP2-33296).
 

Pathways for Fbl14 Antibody (NBP2-33296)

View related products by pathway.

PTMs for Fbl14 Antibody (NBP2-33296)

Learn more about PTMs related to Fbl14 Antibody (NBP2-33296).

Blogs on Fbl14

There are no specific blogs for Fbl14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fbl14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL14
Uniprot