We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human C1QB GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human C1QB Protein [H00000713-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human C1QB GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-253 of Human C1QB

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
C1QB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
53.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human C1QB GST (N-Term) Protein

  • B chain
  • complement C1q subcomponent subunit B
  • complement component 1, q subcomponent, B chain
  • complement subcomponent C1q chain B
  • q subcomponent, beta polypeptide

Background

This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the B-chain polypeptide of human complement subcomponent C1q [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-51139
Species: Hu, Mu, Rt
Applications: Flow, Func, IA, ICC/IF, IHC, IHC-Fr, WB
NBP1-89885
Species: Hu
Applications:  IHC-P
AF1936
Species: Hu
Applications: IP, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P
NBP1-87492
Species: Hu
Applications: IHC,  IHC-P, WB
DIP100
Species: Hu
Applications: ELISA
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NB600-637
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-90256
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
AF1807
Species: Hu
Applications: IP, WB
NBP2-01625
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-70042
Species: Rt
Applications: ELISA
NBP1-32478
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for C1QB Recombinant Protein (H00000713-P01) (0)

There are no publications for C1QB Recombinant Protein (H00000713-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1QB Recombinant Protein (H00000713-P01) (0)

There are no reviews for C1QB Recombinant Protein (H00000713-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C1QB Recombinant Protein (H00000713-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional C1QB Products

Research Areas for C1QB Recombinant Protein (H00000713-P01)

Find related products by research area.

Blogs on C1QB.

Identifying tumoral and stromal transcriptomes that underlie tumor plasticity and stromal neuroinflammatory response in brain metastasis
By Jamshed Arslan, Pharm. D., PhD. Cancers in the brain often come from tumors elsewhere in the body. Several adaptive mechanisms influence brain metastasis, such as blood brain barrier leakage that can be induced by ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human C1QB GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QB