BZW2 Antibody - BSA Free

Western Blot: BZW2 Antibody [NBP1-83183] - Analysis in human cell line SK-BR-3.

Immunohistochemistry-Paraffin: BZW2 Antibody [NBP1-83183] - Staining of human rectum shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Western Blot: BZW2 Antibody [NBP1-83183] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BZW2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BZW2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BZW2 Protein (NBP1-83183PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BZW2 Antibody - BSA Free

• basic leucine zipper and W2 domain-containing protein 2
• basic leucine zipper and W2 domains 2
• HSPC028
• MST017
• MSTP017

Background

BZW2 may be involved in neuronal differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BZW2