BZW2 Antibody

Images

 
Western Blot: BZW2 Antibody [NBP1-83183] - Analysis in human cell line SK-BR-3.
Immunohistochemistry-Paraffin: BZW2 Antibody [NBP1-83183] - Staining of human rectum shows strong cytoplasmic positivity with a granular pattern in glandular cells.
Western Blot: BZW2 Antibody [NBP1-83183] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BZW2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BZW2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BZW2 Protein (NBP1-83183PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BZW2 Antibody

  • basic leucine zipper and W2 domain-containing protein 2
  • basic leucine zipper and W2 domains 2
  • HSPC028
  • MST017
  • MSTP017

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-13656
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-17368
Species: Hu
NBP1-86184
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
MAB8318
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-38572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP2-16293
Species: Hu
Applications: WB, ICC/IF
NBP2-58544
Species: Hu
Applications: WB, ICC/IF
AF7895
Species: Hu
Applications: WB, IHC
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46270
Species: Hu
Applications: WB, IHC
NBP2-38126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for BZW2 Antibody (NBP1-83183) (0)

There are no publications for BZW2 Antibody (NBP1-83183).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BZW2 Antibody (NBP1-83183) (0)

There are no reviews for BZW2 Antibody (NBP1-83183). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BZW2 Antibody (NBP1-83183) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BZW2 Products

Bioinformatics Tool for BZW2 Antibody (NBP1-83183)

Discover related pathways, diseases and genes to BZW2 Antibody (NBP1-83183). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BZW2 Antibody (NBP1-83183)

Discover more about diseases related to BZW2 Antibody (NBP1-83183).
 

Pathways for BZW2 Antibody (NBP1-83183)

View related products by pathway.

Blogs on BZW2

There are no specific blogs for BZW2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BZW2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BZW2