![Western Blot: BXDC1 Antibody [H00084154-B01P] - Analysis of BXDC1 expression in transfected 293T cell line by BXDC1 polyclonal antibody. Lane 1: BXDC1 transfected lysate(33.66 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/BXDC1-Antibody-Western-Blot-H00084154-B01P-img0002.jpg "Western Blot: BXDC1 Antibody [H00084154-B01P] - Analysis of BXDC1 expression in transfected 293T cell line by BXDC1 polyclonal antibody. Lane 1: BXDC1 transfected lysate(33.66 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | BXDC1 (NP_115570.1, 1 a.a. - 306 a.a.) full-length human protein. MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHEKKSKRIKKN |
| Specificity | Reacts with brix domain containing 1. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | RPF2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for BXDC1 Antibody (H00084154-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RPF2 |
| Entrez |
|
| Uniprot |
|
![Western Blot NEDD4 Antibody (683211) [Unconjugated]](https://images.novusbio.com/images2/NEDD4_MAB6218_Western_Blot_10412.jpg)
![Immunohistochemistry PITX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/PITX2_AF7388_Immunohistochemistry_12162.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")