BVES Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BVES Antibody [NBP1-83286] - Staining of human cell line RH-30 shows localization to cell junctions.
Immunohistochemistry-Paraffin: BVES Antibody [NBP1-83286] - Staining of human heart muscle shows strong membranous positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BVES Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BVES
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BVES Protein (NBP1-83286PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BVES Antibody

  • blood vessel epicardial substance
  • BVES
  • H
  • HBVES
  • POP1
  • POP1MGC42413
  • POPDC1
  • POPDC1popeye domain containing 1
  • Popeye domain-containing protein 1
  • Popeye protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87256
Species: Hu
Applications: IHC, IHC-P
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-59476
Species: Hu
Applications: WB
NBP1-88049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92281
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC

Publications for BVES Antibody (NBP1-83286) (0)

There are no publications for BVES Antibody (NBP1-83286).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BVES Antibody (NBP1-83286) (0)

There are no reviews for BVES Antibody (NBP1-83286). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BVES Antibody (NBP1-83286) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BVES Products

Bioinformatics Tool for BVES Antibody (NBP1-83286)

Discover related pathways, diseases and genes to BVES Antibody (NBP1-83286). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BVES Antibody (NBP1-83286)

Discover more about diseases related to BVES Antibody (NBP1-83286).
 

Pathways for BVES Antibody (NBP1-83286)

View related products by pathway.

PTMs for BVES Antibody (NBP1-83286)

Learn more about PTMs related to BVES Antibody (NBP1-83286).

Blogs on BVES

There are no specific blogs for BVES, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BVES Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BVES
Entrez