Butyrylcholinesterase/BCHE Antibody

Images

 
Western Blot: Butyrylcholinesterase/BCHE Antibody [NBP1-69541] - This Anti-BCHE antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.
Immunohistochemistry-Paraffin: Butyrylcholinesterase/BCHE Antibody [NBP1-69541] - Human Lung.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Butyrylcholinesterase/BCHE Antibody Summary

Immunogen
Synthetic peptides corresponding to BCHE(butyrylcholinesterase) The peptide sequence was selected from the N terminal of BCHE. Peptide sequence SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCHE
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Butyrylcholinesterase/BCHE Antibody

  • Acylcholine acylhydrolase
  • BCHE
  • Butyrylcholine esterase
  • Butyrylcholinesterase
  • CHE1
  • CHE1cholinesterase
  • Choline esterase II
  • cholinesterase 1
  • E1
  • EC 3.1.1.8
  • Pseudocholinesterase

Background

Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Butyrylcholinesterase/BCHE Antibody (NBP1-69541) (0)

There are no publications for Butyrylcholinesterase/BCHE Antibody (NBP1-69541).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Butyrylcholinesterase/BCHE Antibody (NBP1-69541) (0)

There are no reviews for Butyrylcholinesterase/BCHE Antibody (NBP1-69541). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Butyrylcholinesterase/BCHE Antibody (NBP1-69541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Butyrylcholinesterase/BCHE Products

Bioinformatics Tool for Butyrylcholinesterase/BCHE Antibody (NBP1-69541)

Discover related pathways, diseases and genes to Butyrylcholinesterase/BCHE Antibody (NBP1-69541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Butyrylcholinesterase/BCHE Antibody (NBP1-69541)

Discover more about diseases related to Butyrylcholinesterase/BCHE Antibody (NBP1-69541).
 

Pathways for Butyrylcholinesterase/BCHE Antibody (NBP1-69541)

View related products by pathway.

PTMs for Butyrylcholinesterase/BCHE Antibody (NBP1-69541)

Learn more about PTMs related to Butyrylcholinesterase/BCHE Antibody (NBP1-69541).

Blogs on Butyrylcholinesterase/BCHE

There are no specific blogs for Butyrylcholinesterase/BCHE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Butyrylcholinesterase/BCHE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCHE
Entrez
Uniprot