Bub1 Antibody (2F9)

Images

 
Western Blot: Bub1 Antibody (2F9) [H00000699-M02] - Analysis of BUB1 expression in transfected 293T cell line by BUB1 monoclonal antibody (M02), clone 2F9.Lane 1: BUB1 transfected lysate(122 KDa).Lane 2: Non-transfected ...read more
Western Blot: Bub1 Antibody (2F9) [H00000699-M02] - BUB1 monoclonal antibody (M02), clone 2F9 Analysis of BUB1 expression in Hela S3 NE.
Immunoprecipitation: Bub1 Antibody (2F9) [H00000699-M02] - Analysis of BUB1 transfected lysate using anti-BUB1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BUB1 MaxPab rabbit polyclonal ...read more
Sandwich ELISA: Bub1 Antibody (2F9) [H00000699-M02] - Detection limit for recombinant GST tagged BUB1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
2F9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Bub1 Antibody (2F9) Summary

Immunogen
BUB1 (AAH28201, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQA
Specificity
BUB1 - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BUB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Bub1 Antibody (2F9)

  • BUB1 budding uninhibited by benzimidazoles 1 homolog
  • Bub1
  • BUB1Amitotic checkpoint serine/threonine-protein kinase BUB1
  • BUB1L
  • budding uninhibited by benzimidazoles 1 (yeast homolog)
  • budding uninhibited by benzimidazoles 1 homolog (yeast)
  • EC 2.7.11.1
  • hBUB1mitotic spindle checkpoint kinase
  • putative serine/threonine-protein kinase

Background

This gene encodes a kinase involved in spindle checkpoint function. The kinase functions in part by phosphorylating a member of the miotic checkpoint complex and activating the spindle checkpoint. Mutations in this gene have been associated with aneuploidy and several forms of cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP3-07374
Species: Hu
Applications: Flow, ICC/IF, PA, WB
NBP1-88517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-85249
Species: Hu, Mu
Applications: WB
NBP1-32775
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB6028
Species: Hu
Applications: WB
NB100-59828
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NBP3-15929
Species: Hu, Mu, Rt
Applications: WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1103
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NBP3-12270
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24509
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
H00000699-M02
Species: Hu
Applications: WB, ELISA, IP, S-ELISA

Publications for Bub1 Antibody (H00000699-M02) (0)

There are no publications for Bub1 Antibody (H00000699-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bub1 Antibody (H00000699-M02) (0)

There are no reviews for Bub1 Antibody (H00000699-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Bub1 Antibody (H00000699-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Bub1 Products

Bioinformatics Tool for Bub1 Antibody (H00000699-M02)

Discover related pathways, diseases and genes to Bub1 Antibody (H00000699-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bub1 Antibody (H00000699-M02)

Discover more about diseases related to Bub1 Antibody (H00000699-M02).
 

Pathways for Bub1 Antibody (H00000699-M02)

View related products by pathway.

PTMs for Bub1 Antibody (H00000699-M02)

Learn more about PTMs related to Bub1 Antibody (H00000699-M02).
 

Research Areas for Bub1 Antibody (H00000699-M02)

Find related products by research area.

Blogs on Bub1

There are no specific blogs for Bub1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Bub1 Antibody (2F9) and receive a gift card or discount.

Bioinformatics

Gene Symbol BUB1
Entrez
OMIM
Uniprot