BTLA/CD272 Antibody - BSA Free

Immunohistochemistry-Paraffin: BTLA/CD272 Antibody [NBP2-49354] - Staining of human tonsil shows moderate positivity in lymphoid cells.

Immunohistochemistry-Paraffin: BTLA/CD272 Antibody [NBP2-49354] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: BTLA/CD272 Antibody [NBP2-49354] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: BTLA/CD272 Antibody [NBP2-49354] - Staining of human small intestine shows moderate positivity in lymphoid cells.

Immunohistochemistry-Paraffin: BTLA/CD272 Antibody [NBP2-49354] - Staining in human tonsil and pancreas tissues . Corresponding BTLA RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BTLA/CD272 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BTLA/CD272 Antibody - BSA Free (NBP2-49354) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPTE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BTLA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BTLA/CD272 Recombinant Protein Antigen (NBP2-49354PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BTLA/CD272 Antibody - BSA Free

• B and T lymphocyte associated
• B and T lymphocyte attenuator
• B- and T-lymphocyte attenuator
• B- and T-lymphocyte-associated protein
• BTLA
• BTLA1
• CD272 antigen
• CD272
• FLJ16065
• MGC129743

Background

BTLA expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 (MIM 600244) and CTLA4 (MIM 123890), BTLA interacts with a B7 homolog, B7H4.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BTLA