BTLA/CD272 Antibody

Images

 
Immunohistochemistry-Paraffin: BTLA/CD272 Antibody [NBP2-49354] - Staining of human tonsil shows moderate positivity in lymphoid cells.
Immunohistochemistry-Paraffin: BTLA/CD272 Antibody [NBP2-49354] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: BTLA/CD272 Antibody [NBP2-49354] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: BTLA/CD272 Antibody [NBP2-49354] - Staining of human small intestine shows moderate positivity in lymphoid cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: BTLA/CD272 Antibody [NBP2-49354] - Staining in human tonsil and pancreas tissues . Corresponding BTLA RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

BTLA/CD272 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPTE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTLA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BTLA/CD272 Recombinant Protein Antigen (NBP2-49354PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTLA/CD272 Antibody

  • B and T lymphocyte associated
  • B and T lymphocyte attenuator
  • B- and T-lymphocyte attenuator
  • B- and T-lymphocyte-associated protein
  • BTLA
  • BTLA1
  • CD272 antigen
  • CD272
  • FLJ16065
  • MGC129743

Background

BTLA expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 (MIM 600244) and CTLA4 (MIM 123890), BTLA interacts with a B7 homolog, B7H4.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB356
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
7268-CT
Species: Hu
Applications: BA
AF1086
Species: Hu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
210-TA
Species: Hu
Applications: BA
664-LI/CF
Species: Hu
Applications: BA
MAB7158
Species: Hu, Mu
Applications: IHC, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
202-IL
Species: Hu
Applications: BA
MAB342
Species: Hu
Applications: AgAct, ICC, WB
169-CS
Species: Hu
Applications: BA
AF3899
Species: Mu
Applications: CyTOF-ready, Flow, ICC
AF2154
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
AF6695
Species: Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
MAB1224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-49354
Species: Hu
Applications: IHC, IHC-P

Publications for BTLA/CD272 Antibody (NBP2-49354) (0)

There are no publications for BTLA/CD272 Antibody (NBP2-49354).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTLA/CD272 Antibody (NBP2-49354) (0)

There are no reviews for BTLA/CD272 Antibody (NBP2-49354). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BTLA/CD272 Antibody (NBP2-49354) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTLA/CD272 Products

Bioinformatics Tool for BTLA/CD272 Antibody (NBP2-49354)

Discover related pathways, diseases and genes to BTLA/CD272 Antibody (NBP2-49354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTLA/CD272 Antibody (NBP2-49354)

Discover more about diseases related to BTLA/CD272 Antibody (NBP2-49354).
 

Pathways for BTLA/CD272 Antibody (NBP2-49354)

View related products by pathway.

PTMs for BTLA/CD272 Antibody (NBP2-49354)

Learn more about PTMs related to BTLA/CD272 Antibody (NBP2-49354).
 

Research Areas for BTLA/CD272 Antibody (NBP2-49354)

Find related products by research area.

Blogs on BTLA/CD272

There are no specific blogs for BTLA/CD272, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTLA/CD272 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTLA