BTG2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: BTG2 Antibody [NBP1-81215] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BTG2 Antibody [NBP1-81215] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.

Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BTG2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BTG2 Antibody - BSA Free (NBP1-81215) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-BTG2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BTG2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BTG2 Protein (NBP1-81215PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BTG2 Antibody - BSA Free

• B-cell translocation gene 2
• BTG family member 2
• BTG family, member 2
• MGC126063
• MGC126064
• NGF-inducible proliferative protein PC3
• PC3nerve growth factor-inducible proliferative
• pheochromacytoma cell-3
• protein BTG2
• TIS21

Background

BTG2 is encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BTG2 Antibody (NBP1-81215)(1)

Publication using NBP1-81215

• Zheng S, Zhou C, Wang Y et al. TRIM6 promotes colorectal cancer cells proliferation and response to thiostrepton by TIS21/FoxM1 J. Exp. Clin. Cancer Res. 2020-01-28 [PMID: 31992359] (ICC/IF)

Bioinformatics

• Gene Symbol: BTG2
• Entrez:
  • 7832(Human)