BTG2 Antibody

Images

 
Western Blot: BTG2 Antibody [NBP1-81215] - Analysis in control (vector only transfected HEK293T lysate) and bTG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: BTG2 Antibody [NBP1-81215] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: BTG2 Antibody [NBP1-81215] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
Specificity
Specificity of human BTG2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BTG2 Protein (NBP1-81215PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTG2 Antibody

  • B-cell translocation gene 2
  • BTG family member 2
  • BTG family, member 2
  • MGC126063
  • MGC126064
  • NGF-inducible proliferative protein PC3
  • PC3nerve growth factor-inducible proliferative
  • pheochromacytoma cell-3
  • protein BTG2
  • TIS21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF262
Species: Hu
Applications: WB, IHC, ICC, Neut
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-81215
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BTG2 Antibody (NBP1-81215) (0)

There are no publications for BTG2 Antibody (NBP1-81215).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTG2 Antibody (NBP1-81215) (0)

There are no reviews for BTG2 Antibody (NBP1-81215). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BTG2 Antibody (NBP1-81215) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTG2 Products

Bioinformatics Tool for BTG2 Antibody (NBP1-81215)

Discover related pathways, diseases and genes to BTG2 Antibody (NBP1-81215). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTG2 Antibody (NBP1-81215)

Discover more about diseases related to BTG2 Antibody (NBP1-81215).
 

Pathways for BTG2 Antibody (NBP1-81215)

View related products by pathway.

PTMs for BTG2 Antibody (NBP1-81215)

Learn more about PTMs related to BTG2 Antibody (NBP1-81215).
 

Research Areas for BTG2 Antibody (NBP1-81215)

Find related products by research area.

Blogs on BTG2

There are no specific blogs for BTG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTG2