BTF Antibody [FITC]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: FITC

BTF Antibody [FITC] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 330-552 of human BTF (NP_001070909.1).
  
  Sequence:
  REEEFKTHHEMKEYSGFAGVSRPRGTFFRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYTPKSKKYFLHDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCLAF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for BTF Antibody [FITC]

• bcl-2-associated transcription factor 1
• BCL2-associated transcription factor 1
• Btf
• BTFKIAA0164bK211L9.1

Background

Btf localization is regulated by apoptotic signals, and loss of emerin binding to Btf may be relevant to muscle wasting in Emery-Dreifuss muscular dystrophy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCLAF1