BRSK2 Antibody - BSA Free

Western Blot: BRSK2 Antibody [NBP2-86587] - Host: Rabbit. Target Name: BRSK2. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BRSK2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BRSK2 Antibody - BSA Free (NBP2-86587) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human BRSK2. Peptide sequence: EEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDPPRKRVDSPMLNRHG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BRSK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BRSK2 Antibody - BSA Free

• BR serine/threonine kinase 2
• BR serine/threonine-protein kinase 2
• C11orf7
• chromsosome 11 open reading frame 7
• EC 2.7.11
• EC 2.7.11.1
• FLJ41362
• PEN11BSAD1
• protein kinase SAD1B
• serine/threonine kinase 29
• serine/threonine kinase SAD-A
• Serine/threonine-protein kinase 29
• Serine/threonine-protein kinase SAD-A
• STK29

Background

BRSK2 (BR serine/threonine-protein kinase 2) is required for the polarization of forebrain neurons which endows axons and dendrites with distinct properties, possibly by locally regulating phosphorylation of microtubule-associated proteins. This enyme is activated by phosphorylation on Thr-174 by STK11 in complex with STE20-related adapter-alpha (STRAD alpha) pseudo kinase and CAB39.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BRSK2