BRIP1/FANCJ Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

BRIP1/FANCJ Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BRIP1.
  
  

  Source: E. coli

  Amino Acid Sequence: FNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPEL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: BRIP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14361.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BRIP1/FANCJ Recombinant Protein Antigen

• ATP-dependent RNA helicase BRIP1
• BACH1
• BACH1BRCA1/BRCA2-associated helicase 1
• BRCA1 interacting protein C-terminal helicase 1
• BRCA1-associated C-terminal helicase 1
• BRCA1-binding helicase-like protein BACH1
• BRCA1-interacting protein 1
• BRCA1-interacting protein C-terminal helicase 1
• BRIP1
• EC 3.6.1
• EC 3.6.4.13
• FACJ
• FANCJ
• FANCJFanconi anemia group J protein
• FLJ90232
• MGC126521
• MGC126523
• OF
• Protein FACJ

Background

The Fanconi anemia group subunit J protein (FANCJ), also called BRIP1 or BACH1, is a helicase that interacts with the BRCT domain of BRCA1 and has a role in BRCA1-dependent DNA repair and checkpoint. Defects in FANCJ cause the autosomal recessive disorder, Fanconi anemia. BRIP1/FANCJ has a function in the Fanconi anemia pathway that is independent of BRCA1 and downstream of FANCD2 activation.

FANCG antibodies are useful for DNA repair studies and cell cycle research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: BRIP1