BRIC Antibody (3F10)


Sandwich ELISA: BRIC Antibody (3F10) [H00005205-M02] - Detection limit for recombinant GST tagged ATP8B1 is 1 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications ELISA

Order Details

BRIC Antibody (3F10) Summary

ATP8B1 (NP_005594.1 471 a.a. - 551 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA
Reacts with ATPase, class I, type 8B, member 1.
IgG1 Kappa
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
Protein A purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BRIC Antibody (3F10)

  • ATPase class I type 8B member 1
  • ATPase, aminophospholipid transporter, class I, type 8B, member 1
  • ATPase, class I, type 8B, member 1
  • BRIC
  • EC 3.6.3
  • EC
  • Familial intrahepatic cholestasis type 1
  • FIC1phospholipid-transporting ATPase IC
  • PFICE1-E2 ATPase
  • probable phospholipid-transporting ATPase IC


This gene encodes a member of the P-type cation transport ATPase family, which belongs to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Mutations in this gene may result in progressive familial intrahepatic cholestasis type 1 and in benign recurrent intrahepatic cholestasis. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for BRIC Antibody (H00005205-M02) (0)

There are no publications for BRIC Antibody (H00005205-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRIC Antibody (H00005205-M02) (0)

There are no reviews for BRIC Antibody (H00005205-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BRIC Antibody (H00005205-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BRIC Products

Bioinformatics Tool for BRIC Antibody (H00005205-M02)

Discover related pathways, diseases and genes to BRIC Antibody (H00005205-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRIC Antibody (H00005205-M02)

Discover more about diseases related to BRIC Antibody (H00005205-M02).

Pathways for BRIC Antibody (H00005205-M02)

View related products by pathway.

PTMs for BRIC Antibody (H00005205-M02)

Learn more about PTMs related to BRIC Antibody (H00005205-M02).

Blogs on BRIC

There are no specific blogs for BRIC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BRIC Antibody (3F10) and receive a gift card or discount.


Gene Symbol ATP8B1