BRIC Antibody (3F10) - Azide and BSA Free

ELISA: BRIC Antibody (3F10) [H00005205-M02] - Detection limit for recombinant GST tagged ATP8B1 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 3F10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BRIC Antibody (3F10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ATP8B1 (NP_005594.1, 471 a.a. ~ 551 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA
• Specificity: Reacts with ATPase, class I, type 8B, member 1.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATP8B1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BRIC Antibody (3F10) - Azide and BSA Free

• ATPase class I type 8B member 1
• ATPase, aminophospholipid transporter, class I, type 8B, member 1
• ATPase, class I, type 8B, member 1
• ATPICPFIC1
• BRIC
• EC 3.6.3
• EC 3.6.3.1
• Familial intrahepatic cholestasis type 1
• FIC1phospholipid-transporting ATPase IC
• PFICE1-E2 ATPase
• probable phospholipid-transporting ATPase IC

Background

This gene encodes a member of the P-type cation transport ATPase family, which belongs to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Mutations in this gene may result in progressive familial intrahepatic cholestasis type 1 and in benign recurrent intrahepatic cholestasis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP8B1
• Entrez:
  • 5205(Human)
• Uniprot:
  • NP_005594(Human)