BRI3BP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: BRI3BP Antibody [NBP1-88564] - Staining of human cell line RT4 shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BRI3BP Antibody [NBP1-88564] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BRI3BP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BRI3BP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BRI3BP Protein (NBP1-88564PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BRI3BP Antibody - BSA Free

• BNAS1
• BRI3 binding protein
• BRI3-binding protein
• Cervical cancer 1 proto-oncogene-binding protein KG19
• cervical cancer oncogene binding protein
• HCCR-1
• HCCR-2
• HCCRBP-1
• KG19I3-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BRI3BP