BRI3BP Antibody


Immunocytochemistry/ Immunofluorescence: BRI3BP Antibody [NBP1-88564] - Staining of human cell line RT4 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: BRI3BP Antibody [NBP1-88564] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

BRI3BP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVV
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BRI3BP Protein (NBP1-88564PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BRI3BP Antibody

  • BNAS1
  • BRI3 binding protein
  • BRI3-binding protein
  • Cervical cancer 1 proto-oncogene-binding protein KG19
  • cervical cancer oncogene binding protein
  • HCCR-1
  • HCCR-2
  • HCCRBP-1
  • KG19I3-binding protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Mu
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC

Publications for BRI3BP Antibody (NBP1-88564) (0)

There are no publications for BRI3BP Antibody (NBP1-88564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRI3BP Antibody (NBP1-88564) (0)

There are no reviews for BRI3BP Antibody (NBP1-88564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BRI3BP Antibody (NBP1-88564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BRI3BP Products

Bioinformatics Tool for BRI3BP Antibody (NBP1-88564)

Discover related pathways, diseases and genes to BRI3BP Antibody (NBP1-88564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for BRI3BP Antibody (NBP1-88564)

View related products by pathway.

Blogs on BRI3BP

There are no specific blogs for BRI3BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BRI3BP Antibody and receive a gift card or discount.


Gene Symbol BRI3BP