Brg1 Antibody (4N9C4)

Western Blot: Brg1 Antibody (4N9C4) [NBP3-15773] - Analysis of lysates from Rat brain using BRG1/SMARCA4 Rabbit mAb at 1:1000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 45s.

Western Blot: Brg1 Antibody (4N9C4) [NBP3-15773] - Analysis of lysates from Mouse brain using BRG1/SMARCA4 Rabbit mAb at 1:1000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.

Immunohistochemistry-Paraffin: Brg1 Antibody (4N9C4) [NBP3-15773] - Analysis of paraffin-embedded Human cervix cancer using BRG1/SMARCA4 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry-Paraffin: Brg1 Antibody (4N9C4) [NBP3-15773] -Analysis of paraffin-embedded Human colon carcinoma using BRG1/SMARCA4 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Brg1 Antibody (4N9C4) [Brg1] - Immunohistochemistry analysis of paraffin-embedded Human colon using Brg1 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Western Blot: Brg1 Antibody (4N9C4) [Brg1] - Western blot analysis of lysates from HeLa cells using Brg1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Immunohistochemistry: Brg1 Antibody (4N9C4) [Brg1] - Immunohistochemistry analysis of paraffin-embedded Human endometrium cancer using Brg1 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Brg1 Antibody (4N9C4) [Brg1] - Confocal imaging of NIH-3T3 cells using Brg1 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunohistochemistry: Brg1 Antibody (4N9C4) [Brg1] - Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma using Brg1 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Brg1 Antibody (4N9C4) [Brg1] - Immunohistochemistry analysis of paraffin-embedded Human placenta using Brg1 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 4N9C4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Brg1 Antibody (4N9C4) Summary

• Description: Novus Biologicals Rabbit Brg1 Antibody (4N9C4) (NBP3-15773) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Brg1 (P51532). LQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQ
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SMARCA4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:800
  • Immunohistochemistry 1:100 - 1:500
  • Immunohistochemistry-Paraffin 1:100 - 1:500
  • Western Blot 1:1000 - 1:2000
• Theoretical MW: 185 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Brg1 Antibody (4N9C4)

• ATP-dependent helicase SMARCA4
• BAF190
• BAF190A
• brahma protein-like 1
• Brg1
• BRG1-associated factor 190A
• BRG1SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 4
• BRM/SWI2-related gene 1
• EC 3.6.1
• EC 3.6.4.-
• FLJ39786
• global transcription activator homologous sequence
• homeotic gene regulator
• hSNF2b
• Mitotic growth and transcription activator
• nuclear protein GRB1
• Protein brahma homolog 1
• Protein BRG-1
• RTPS2
• SMARCA4
• SNF2
• SNF2B
• SNF2-beta
• SNF2L4
• SNF2LB
• SNF2-like 4
• subfamily a, member 4
• sucrose nonfermenting-like 4
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin
• SWI2
• transcription activator BRG1

Background

BRG1 is encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Alternatively spliced transcripts have been found for this gene, but their full-length natures have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMARCA4