Recombinant Human BRD8 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human BRD8 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 33-128 of Human BRD8

Source: Wheat Germ

Amino Acid Sequence: RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
BRD8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BRD8 Protein

  • bromodomain containing 8
  • bromodomain-containing protein 8
  • Skeletal muscle abundant protein
  • SMAP2
  • SMAPp120Skeletal muscle abundant protein 2
  • Thyroid hormone receptor coactivating protein of 120 kDa
  • trCP120

Background

BRD8 - bromodomain containing 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5094
Species: Hu, Mu, Rt
Applications: WB
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-48320
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1002
Species: Mu
Applications: WB, Simple Western, IHC
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00010902-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for BRD8 Partial Recombinant Protein (H00010902-Q01) (0)

There are no publications for BRD8 Partial Recombinant Protein (H00010902-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRD8 Partial Recombinant Protein (H00010902-Q01) (0)

There are no reviews for BRD8 Partial Recombinant Protein (H00010902-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRD8 Partial Recombinant Protein (H00010902-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for BRD8 Partial Recombinant Protein (H00010902-Q01)

Discover related pathways, diseases and genes to BRD8 Partial Recombinant Protein (H00010902-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRD8 Partial Recombinant Protein (H00010902-Q01)

Discover more about diseases related to BRD8 Partial Recombinant Protein (H00010902-Q01).
 

Pathways for BRD8 Partial Recombinant Protein (H00010902-Q01)

View related products by pathway.

Research Areas for BRD8 Partial Recombinant Protein (H00010902-Q01)

Find related products by research area.

Blogs on BRD8

There are no specific blogs for BRD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BRD8 Antibody
NB100-79781

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BRD8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BRD8