BRD3 Antibody (7G6)

Images

 
Western Blot: BRD3 Antibody (7G6) [H00008019-M02] - BRD3 monoclonal antibody (M02), clone 7G6 Analysis of BRD3 expression in HeLa.
Immunohistochemistry-Paraffin: BRD3 Antibody (7G6) [H00008019-M02] - Analysis of monoclonal antibody to BRD3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Sandwich ELISA: BRD3 Antibody (7G6) [H00008019-M02] - Detection limit for recombinant GST tagged BRD3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
7G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BRD3 Antibody (7G6) Summary

Immunogen
BRD3 (AAH32124, 418 a.a. ~ 556 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRDHFLTCGV
Localization
Nuclear
Specificity
BRD3 - bromodomain containing 3
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BRD3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Control
BRD3 Knockout 293T Cell Lysate

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BRD3 Antibody (7G6)

  • bromodomain containing 3
  • bromodomain-containing protein 3
  • KIAA0043FLJ41328
  • ORFXbromodomain-containing 3
  • RING3LFLJ23227
  • RING3-like protein

Background

This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-76393
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CHIP-SEQ
AF3646
Species: Hu
Applications: WB, ICC
NBP1-80294
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P, KD
NBP2-14163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ce, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IHC-FrFl
H00003304-M02
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008019-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for BRD3 Antibody (H00008019-M02) (0)

There are no publications for BRD3 Antibody (H00008019-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRD3 Antibody (H00008019-M02) (0)

There are no reviews for BRD3 Antibody (H00008019-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRD3 Antibody (H00008019-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BRD3 Products

Bioinformatics Tool for BRD3 Antibody (H00008019-M02)

Discover related pathways, diseases and genes to BRD3 Antibody (H00008019-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRD3 Antibody (H00008019-M02)

Discover more about diseases related to BRD3 Antibody (H00008019-M02).
 

Pathways for BRD3 Antibody (H00008019-M02)

View related products by pathway.

PTMs for BRD3 Antibody (H00008019-M02)

Learn more about PTMs related to BRD3 Antibody (H00008019-M02).
 

Research Areas for BRD3 Antibody (H00008019-M02)

Find related products by research area.

Blogs on BRD3.

Understanding the relationship between NUT and BET proteins in NMC
NUT has been found to fuse with bromodomain-containing proteins 3 and 4 (BRD3 and BRD4) in NUT midline carcinoma (NMC), a very rare, extremely aggressive, and genetically defined human cancer. NMC has recently been designated as a sub classificati...  Read full blog post.

NUT - A Protein Coding Gene
The NUT gene is found on chromosome 15q14 and encodes for the NUT protein which is a key component of the RNA polymerase II Mediator complex. This multi-subunit assembly is required for all RNA pol II-dependent transcriptional activation, coordinating...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRD3 Antibody (7G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol BRD3
Entrez
OMIM
Uniprot