BRCAA1 Recombinant Protein Antigen

Images

 
There are currently no images for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BRCAA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BRCAA1

Source: E. coli

Amino Acid Sequence: NCKLRRLSKPPFQTNPSPEMVSKLDLTDAKNSDTAHIKSIEITSILNGLQASESSAEDSEQEDERGAQDM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARID4B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17218.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BRCAA1 Recombinant Protein Antigen

  • 180 kDa Sin3-associated polypeptide
  • ARID domain-containing protein 4B
  • AT rich interactive domain 4B (RBP1- like)
  • AT rich interactive domain 4B (RBP1-like)
  • AT-rich interactive domain-containing protein 4B
  • BRCAA1DKFZp313M2420
  • breast cancer-associated antigen 1
  • Breast cancer-associated antigen BRCAA1
  • breast carcinoma-associated antigen
  • Histone deacetylase complex subunit SAP180
  • Rb-binding protein homolog
  • RBBP1L1RBP1L1BCAA
  • RBP1-like protein
  • retinoblastoma binding protein 1-like 1
  • Retinoblastoma-binding protein 1-like 1
  • SAP180MGC163290
  • SIN3A-associated protein 180
  • Sin3-associated polypeptide p180

Background

ARID4B (AT-rich interactive domain-containing protein 4B) is also known as RbBP1L1 (retinoblastoma binding protein 1-like 1) and is a retinoblastoma binding protein and member of the AT-rich interaction domain (ARID) family of proteins. In addition to the ARID DNA binding domain, ARID4B also contains a chromo domain and a TUDOR domain, indicating a function in chromatin organization and protein-protein interactions with methylated protein substrates. As a subunit of the SIN3A transcriptional co-repressor, ARID4B is implicated to be involved in chromatin remodeling and epigenetic modifications. ARID4B may play a role in the pathogenesis of breast cancer and other malignancies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB100-1595
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-157
Species: Hu
Applications: IHC,  IHC-P, KO, WB
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-33705
Species: Hu
Applications: IHC,  IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP1-26616
Species: Hu
Applications: IP, WB
NBP3-17218PEP
Species: Hu
Applications: AC

Publications for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP) (0)

There are no publications for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP) (0)

There are no reviews for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BRCAA1 Products

Array NBP3-17218PEP

Research Areas for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP)

Find related products by research area.

Blogs on BRCAA1

There are no specific blogs for BRCAA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BRCAA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID4B