BRAF35 Antibody


Immunohistochemistry: BRAF35 Antibody [NBP2-49621] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

BRAF35 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGPKAPVTGYV
Specificity of human BRAF35 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BRAF35 Recombinant Protein Antigen (NBP2-49621PEP)

Reactivity Notes

Mouse (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BRAF35 Antibody

  • BRAF35Sox-like transcriptional factor
  • high-mobility group 20B
  • HMG domain-containing protein 2
  • HMG domain-containing protein HMGX2
  • HMGX2FLJ26127
  • HMGXB2member 1-related
  • SMARCE1-related protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for BRAF35 Antibody (NBP2-49621) (0)

There are no publications for BRAF35 Antibody (NBP2-49621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRAF35 Antibody (NBP2-49621) (0)

There are no reviews for BRAF35 Antibody (NBP2-49621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BRAF35 Antibody (NBP2-49621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for BRAF35 Antibody (NBP2-49621)

Discover related pathways, diseases and genes to BRAF35 Antibody (NBP2-49621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRAF35 Antibody (NBP2-49621)

Discover more about diseases related to BRAF35 Antibody (NBP2-49621).

Pathways for BRAF35 Antibody (NBP2-49621)

View related products by pathway.

PTMs for BRAF35 Antibody (NBP2-49621)

Learn more about PTMs related to BRAF35 Antibody (NBP2-49621).

Research Areas for BRAF35 Antibody (NBP2-49621)

Find related products by research area.

Blogs on BRAF35

There are no specific blogs for BRAF35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BRAF35 Antibody and receive a gift card or discount.


Gene Symbol HMG20B