Bradykinin RB2/BDKRB2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Bradykinin RB2/BDKRB2 Antibody [NBP2-14351] -Staining of human cerebral cortex shows strong positivity in neuronal processes.

Immunohistochemistry-Paraffin: Bradykinin RB2/BDKRB2 Antibody [NBP2-14351] - Staining of human stomach shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Bradykinin RB2/BDKRB2 Antibody [NBP2-14351] - Staining of human skeletal muscle shows no positivity myocytes as expected.

Immunohistochemistry-Paraffin: Bradykinin RB2/BDKRB2 Antibody [NBP2-14351] - Staining of human testis shows low positivity in cells in seminiferous ducts as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Bradykinin RB2/BDKRB2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: FSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BDKRB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID 28757212).
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Bradykinin RB2/BDKRB2 Protein (NBP2-14351PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Bradykinin RB2/BDKRB2 Antibody - BSA Free

• B2 bradykinin receptor
• B2R
• BDKRB2
• BK-2 receptor
• BK2
• BK-2
• BKR2
• Bradykinin RB2
• bradykinin receptor B2
• BradykininRB2
• BRB2
• DKFZp686O088

Background

BDKRB2, or Bradykinin Receptor B2, mediates smooth muscle contraction, induces relaxation of arteries, and stimulates diuresis. In addition, bradykinin B2 receptor has been implicated in inflammation and response to pain. This receptor is encoded by a single-copy gene. Two variants are produced by alternate start codons. BDKRB2/Bradykinin B2 receptor expression has been reported in blood, brain, eye, kidney, liver, lung, prostate, skin, small intestine, synovium, uterus, and vessel. ESTs have been isolated from colon, connective tissue, heart, heart/melanocyte/uterus, kidney, lung, placenta, and thyroid libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Bradykinin RB2/BDKRB2 Antibody (NBP2-14351)(2)

Publications using NBP2-14351

• Niewiarowska-Sendo A, Kozik A, Guevara-Lora I. Influence of bradykinin B2 receptor and dopamine D2 receptor on the oxidative stress, inflammatory response, and apoptotic process in human endothelial cells. PLoS ONE. 2018-11-14 [PMID: 30427893] (ICC/IF, Human)
• Niewiarowska-Sendo A, Polit A, Piwowar M et al. Bradykinin B2 and dopamine D2 receptors form a functional dimer Biochim. Biophys. Acta 2017-07-27 [PMID: 28757212] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: BDKRB2